Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010219001
Length(AA) : 647
Localization : scaffold_68
Number of EST contigs matching the gene: 1
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001537928.1| Score: 1085 E_value: 1e-116
KEGG Definition: peroxisomal membrane protein Pex17, putative
Accession: afm:AFUA_2G08410 Score: 1051 E_value: 1e-112
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: P87200|PEX17_YARLI
Gene Ontology:
GO:0005778 = Cellular component: peroxisomal membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.214NO0.579NO0.246NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1390.1070.776_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.27403First60=0.17469PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010219001
MVVDRRLDNILRILLQPGAADPNNADASSVYASAATVLATLTNPLNVSLL
STQILISPAIWEENFDGLKAGLRVFGVFQSATVGKFETQGSILSVEEWIS
ALVRGANNNVPRWKHLLLLGGVLSADQERSQLPRVTRTSLEQAFCRAVNL
SVESNARHELEADVLSLQKRLSTTMQALLPVIVKSMYNSREGFQSGYFLS
TIDHDIMTIEGKLVWPSKSNSFLELQQRSGRPLFAAMSGLARLAAASIRH
SQDPMVLHQFVDSLWGFSQVLSAQWKMNGLSEIPMSEEKNRVDEESLKAT
LPVVWQILKAILFGSTMILQELTARIAESPLLSGPDHGPTFSSKILLILR
NFYFITSRLGPNAFSSYNFVYLSAIDILTTYPIPSEKFIIDIAPAQAGTI
PPTLPERLFDLYFLNTVEHFTHSLPQKINEETTLPCTSVYLLPSSDASLH
AHFESAHSVMLSIIGAPKSADLGARILPFYVDTVFKTFPASLSARQFRLA
FGTLIRECSPPQAISSLQPHLAEVIMEILAERAKIASTEPLDNKVDEGAV
GLSEKDVCILALIDGLPAMEVGVMERWLDPTADLLNSVGNEGSKGRIRER
FWDVLSGELDVERAEVAVRWWTSANGRDKVLLGLGKGEGVEGIRAML

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig133 peroxisomal membrane protein Pex17, putative [Neosartorya fischeri NRRL 181]5e-36


Manual Annotation:

Please find below the necessary files for GSTUMT00010219001 annotation :

link to GSTUMT00010219001 Artemis file
link to scaffold_68 sequence file
link to scaffold_68ESTs