Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010106001
Length(AA) : 736
Localization : scaffold_67
Number of EST contigs matching the gene: 3
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: decapping enzyme Dcp2, putative
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP51979.1| Score: 774 E_value: 6e-80
KEGG Definition: decapping enzyme Dcp2, putative
Accession: afm:AFUA_5G12420 Score: 799 E_value: 4e-83
KOG Definition: Decapping enzyme complex
Classification: [
Kog Number: KOG2937 Score: 552 E_value: 7e-57
PFAM Definition: DCP2, Dcp2, box A domain. This domain is always found to the amino terminal side of pfam00293. This domain is specific to mRNA decapping protein 2 and this region has been termed Box A. Removal of the cap structure is catalysed by the Dcp1-Dcp2 complex..
Pfam Number: pfam05026 Score: 280 E_value: 2e-25
Swissprot: Q9CYC6|DCP2_MOUSE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.084NO0.154NO0.068NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0360.1960.905_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00953First60=0.00317PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010106001
MDLTNSYIFSNSTLAEILDDLCVRFIINLPEEELSSIERICFQIEEAQWY
FEDFIRETNPMLPTLPLRTFLNKIFAICPLPILKEMPPERAENAFAEFMA
YKTRVPVRGAVLLNSAMDKCVLVKGWKSGASWSFPRGKINKDERDEDCAA
REVLEETSYDIEGRVHSDHFVEVTMREQNMRLYIIPGVPEETKFEPRTRK
EISKIAWHHLSDLPTFSKKKNQQNIQQSDVRTGKYYMVAPFLKELRKWIS
TSGKKWLEEQKQMPSSATLIGDETEIEDIIPPQAVDSSAELRNLLGIPHN
GAAKPNGNYNTTGTDEATARLKNFLNLSGPVTEPVDASSKLKSLLNVGGG
SNTQITEQSLKPNPQMLLSILQNKGGPSNPQPTATPPILPQPMGQHTPSI
PTPTHHSPTGPPNNLMEGFHSQIRPPHPPSPPPTFSFLGPHQMYDPLHSQ
PHPPNHLFTHRQFNQPIFPSNHHGESPTFPNRPPGWRPSPTPLDALMPSP
VPSKPPDPGQAVMLLSILKSAAPSTPATPHTPPPARAANPSRTPSQPYHQ
QEQQTKQIGLQTPPALKTSGSQHKNNLLDTLRGSTTETTRPASATLIAQY
DFPPRHMAPLASENAPARPLHSATASPQISRFPSRTPNASHTPVPASTTP
QPTSFDRRQSVSSEQQRALLAIFTNGASTPHEDPAIISSSEGAKPTTPLR
SRTTSFARRVTPMSPLSREKDGLLAYLETVAKEGGQ

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2545 No hit found
Contig3740 hypothetical protein MGG_06410 [Magnaporthe grisea 70-15]2e-31
SY0AAB36YH14FM1 decapping enzyme Dcp2, putative [Aspergillus fumigatus A1163]2e-21


Manual Annotation:

Please find below the necessary files for GSTUMT00010106001 annotation :

link to GSTUMT00010106001 Artemis file
link to scaffold_67 sequence file
link to scaffold_67ESTs