Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010084001
Length(AA) : 701
Localization : scaffold_66
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : Tmelhex2  [+]

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001216736.1| Score: 2016 E_value: 0.0
KEGG Definition: beta-N-hexosaminidase, putative [EC:3.2.1.52]; K01207 beta-N-acetylhexosaminidase
Accession: afm:AFUA_2G00640 Score: 1941 E_value: 0.0
KOG Definition: Beta-N-acetylhexosaminidase
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG2499 Score: 184 E_value: 3e-14
PFAM Definition: Glyco_hydro_20, Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold..
Pfam Number: pfam00728 Score: 375 E_value: 2e-36
Swissprot: P96155|HEX1_VIBFU

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.954YES0.975YES0.910YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0380.9480.038S118

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.0714First60=2.06298PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010084001
MQLLVLLFLTLSLLGAEAYNALPPVPWRYSTGTFKFSLRRPPTIYLQESA
AEARDTDGLTLIPPSVREFAETFAGDLKDRFHVDVRVECVAFERGRAGPG
IYLGIDEGPGKYTYESGIETSEGYTISVAEDSELMLAREVGGVHPGDRRD
EVIELKAGRAVDSPAYPTRGFLLDAGRKWYSADFLKDLCTYASFFKFSEF
HYHASDNYPLNRGRNSTWQNIYSQFSLIPDNVALHPLVARHNESHSRAEF
ESIQRHCASRGITIIPEIEAPGHALAITKWKPELALTNKKDLLNLTHPDT
IPTVKAIWSEFLPWFQTKEVHIGADEYDSDLADVYIHFVNTMSEFIFTTA
GKKVRIWGTHEPSNTSVISRAITTQHWQYGQSDPVQLERDGYEIINSEDW
WGYTGLKNDHTPILPAPYPQYFNEARVLNFGGVNGWQWEPSLYNPFNTTA
EWQIPIESKRNKGAIMATWNDNGPDATTQLEAYYCIRDGIPVVGARSWSG
HRGPEIDVGTLEISKSILTNNAPGQNLDRRLGGGYNLGDLLFDWPTGTLG
VRLATKSKGMNYTMQITYTSPFTLSSAHDAVSLTLTPDSTLIFTADGFEY
PLRSVAESAFDPSHPGRIWSNDTASTHIPVSLPPIATITIQTDRIGGSRV
WQNGTFLGRFEVFIFGGRNTLFSWSQMAFVAPVEQVRGGVHRVRIWEGLV
G

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3940 conserved hypothetical protein [Aspergillus terreus NIH2624]0.0
SY0AAD27YJ12FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]4e-20


Manual Annotation:

Please find below the necessary files for GSTUMT00010084001 annotation :

link to GSTUMT00010084001 Artemis file
link to scaffold_66 sequence file
link to scaffold_66ESTs