Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00010039001
Length(AA) : 212
Localization : scaffold_65
Number of EST contigs matching the gene: 3
Number of ESTs : 10
  User annotation : Tmelspf31  [+]

Blast Results:

Nr Definition: DnaJ domain protein
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001258226.1| Score: 707 E_value: 5e-73
KEGG Definition: hypothetical protein
Accession: fgr:FG09767.1 Score: 682 E_value: 2e-70
KOG Definition: Predicted molecular chaperone (DnaJ superfamily)
Classification: [Posttranslational modification
Kog Number: KOG1150 Score: 335 E_value: 2e-32
PFAM Definition: DnaJ, DnaJ domain. DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature..
Pfam Number: pfam00226 Score: 147 E_value: 1e-10
Swissprot: O74746|SPF31_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.015NO0.031NO0.027NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0590.0560.951_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00022First60=0.00022PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00010039001
MSEEDTAVDKDILAELDREASDYLKDAEISRILNAFKLDAYAILDLKPGV
PESDIKLQFRRKSLLIHPDKTKNPQAPDAFDRLKKAQGVLMDEKARTRLD
EAIADARMLLIREKKWTVDNPELTGEEFAVEWREKTKFVLIESELRRRKQ
VKAQMAEEGREKRKADEEVEARKRKRENEIAWEETRDQRINSWRDFKKGE
EKKKKKKAKPLG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2572 DnaJ domain protein [Neosartorya fischeri NRRL 181]7e-73
Contig4065 hypothetical protein CHGG_04635 [Chaetomium globosum CBS 148.51]2e-48
SY0AAB41YK23FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00010039001 annotation :

link to GSTUMT00010039001 Artemis file
link to scaffold_65 sequence file
link to scaffold_65ESTs