Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009963001
Length(AA) : 320
Localization : scaffold_63
Number of EST contigs matching the gene: 2
Number of ESTs : 32
  User annotation : TmelMRGA  [+]

Blast Results:

Nr Definition: hypothetical protein SS1G_04409
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001594602.1| Score: 472 E_value: 2e-45
KEGG Definition: hypothetical protein
Accession: fgr:FG06871.1 Score: 429 E_value: 1e-40
KOG Definition: C2H2-type Zn-finger protein
Classification: [Transcription].
Kog Number: KOG2462 Score: 160 E_value: 8e-12
PFAM Definition: No Hit Found
Swissprot: P39959|YEW0_YEAST

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.023NO0.075NO0.025NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0710.060.936_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00021First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009963001
MLGMGKDDIKTEGRDFAHGFLGLEEQLSDFESDNELVSGLMNMPQNTINP
VDLLGNRRQRDGFDDEEGWEMDDLSDDESVSGDINSQEFQAPLSPPPSDS
SRGGSAIPPTKQRKVQRKIKAETYEDSEAELDDIIANARANGYPESTCDG
DFFSHSSCHESSITPAPTESSFYESSDSQVVSPAPVVRRGRKQSLTEDPS
KTFVCHLCSRRFRRQEHLKRHFRSLHTKDKPFSCGECGKKFSRSDNLSQH
ARTHGSTTIHMTLIDGDMMGEDDSDVLSEHSESLGIVLVNATQASSGIKD
KISSSSPESKKSRRKRKRDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig111 hypothetical protein SS1G_04409 [Sclerotinia sclerotiorum 1980]1e-55
Contig4342 hypothetical protein SS1G_04409 [Sclerotinia sclerotiorum 1980]5e-16


Manual Annotation:

Please find below the necessary files for GSTUMT00009963001 annotation :

link to GSTUMT00009963001 Artemis file
link to scaffold_63 sequence file
link to scaffold_63ESTs