Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009952001
Length(AA) : 484
Localization : scaffold_63
Number of EST contigs matching the gene: 1
Number of ESTs : 9
  User annotation : MANTUM00009952001  [+]

Blast Results:

Nr Definition: hypothetical protein FG11427.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_391603.1| Score: 967 E_value: 1e-102
KEGG Definition: hypothetical protein
Accession: fgr:FG11427.1 Score: 967 E_value: 1e-103
KOG Definition: Multicopper oxidases
Classification: [Secondary metabolites biosynthesis
Kog Number: KOG1263 Score: 567 E_value: 8e-59
PFAM Definition: Cu-oxidase_2, Multicopper oxidase. This entry contains many divergent copper oxidase-like domains that are not recognised by the pfam00394 model..
Pfam Number: pfam07731 Score: 293 E_value: 4e-27
Swissprot: Q96WM9|LAC2_BOTFU
Gene Ontology:
GO:0008471 = Molecular function: laccase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.088NO0.234NO0.064NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0620.0470.939_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00876First60=0.00053PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009952001
MHGITQCPIAPEHTYTYKFRATEYGHTWYHSHYSLQYPDGVLGPMIIHGP
QSANYDVDVGTVLVSDWSHETAFIDFFGELTGNPPPMQSNLLQGRGRFPC
FQGDPRCVGPPGNYYELNFEKGKKYLLRLINTSTASQFKFSIDNHILTVV
SADFVPIHPYQTKYLNIGIGQRYSVIVEANPSGPDVSVNRDYWIRTIPAA
GCNNIQFPVKQTGIIRYFSNSTYTLPVSSFWVTQKGQTTEPDDCDDEDMK
NLVPVVPKSLVPGDYANNYSSDTYEVGLTEPTIENPMPHGNYSRWDIATL
PMWLEWGNPTILNLDKNVSNMSQELSIVPEDYQNRWVVLVVVGNLTLPSG
HSAGKQSIPTRHPIHLHGHDFILLAQNDTQWDASDWTAADAFNNMNYNNP
PRRDVALLPRNGYIVIAFKTDNPGPWLIHCHIAWHASSGLAMQIMEDQEN
IERTIRDKRAIQETCDAWNTWNATRNVEQDDSGV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1699 Lcc2 [Fusarium oxysporum]4e-96


Manual Annotation:

Please find below the necessary files for GSTUMT00009952001 annotation :

link to GSTUMT00009952001 Artemis file
link to scaffold_63 sequence file
link to scaffold_63ESTs