Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009948001
Length(AA) : 375
Localization : scaffold_63
Number of EST contigs matching the gene: 3
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: AMP-binding enzyme, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001259838.1| Score: 942 E_value: 1e-103
KEGG Definition: AMP-binding enzyme, putative [EC:6.2.1.3]; K01897 long-chain fatty-acid-CoA ligase
Accession: afm:AFUA_5G08470 Score: 938 E_value: 1e-99
KOG Definition: Long chain fatty acid acyl-CoA ligase
Classification: [Lipid transport and metabolism].
Kog Number: KOG1177 Score: 500 E_value: 4e-51
PFAM Definition: AMP-binding, AMP-binding enzyme..
Pfam Number: pfam00501 Score: 409 E_value: 1e-40
Swissprot: Q0P4F7|ACSF2_DANRE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.592YES0.862NO0.549YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.20.4120.253S519

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.11345First60=0.01248PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009948001
MLGCRLRGLGFSGIGIVAAEVTTEDLQRYGTTAVTRLDHRLTPSGNNPRR
SFPPSLLIASKANVTSVISSHQNTRLTYSSLHTQSTSLAHGLKSLGVQRG
DRVAVSLGNNIEFALATYAIFKLGAVLVPLNPSFNTAQVVSALNHLSATH
LLIGLETNLPRKPPRSNYKLLRELVPGCQSGGVVASELVPSLGRVVVVDN
TRDKGKGGDGFKAFSKFPDVLEDGEGKAHLTEEGMGVDDVVNIQFTSGTT
SLPKAACLTHRSILNNGKSIGDRMLLTNKDVICCPPPLFHCFGSVLGYMA
SATHASCIVFPAECFDAKATLHAVQQEKCTALYGVPTMFTAELELLASGE
VEQKGFEHIRTGIAAGIYDSPSLND

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig827 AMP-binding enzyme, putative [Neosartorya fischeri NRRL 181]2e-52
Contig4250 hypothetical protein CIMG_06794 [Coccidioides immitis RS]8e-53
Contig7281 AMP-binding enzyme, putative [Neosartorya fischeri NRRL 181]9e-49


Manual Annotation:

Please find below the necessary files for GSTUMT00009948001 annotation :

link to GSTUMT00009948001 Artemis file
link to scaffold_63 sequence file
link to scaffold_63ESTs