Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009940001
Length(AA) : 707
Localization : scaffold_63
Number of EST contigs matching the gene: 3
Number of ESTs : 19
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_04201
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001244760.1| Score: 1912 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: fgr:FG01017.1 Score: 1848 E_value: 0.0
KOG Definition: Dipeptidyl peptidase III
Classification: [General function prediction only].
Kog Number: KOG3675 Score: 876 E_value: 2e-94
PFAM Definition: Peptidase_M49, Peptidase family M49..
Pfam Number: pfam03571 Score: 1500 E_value: 1e-167
Swissprot: Q08225|DPP3_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0042802 = Molecular function: identical protein binding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.034NO0.096NO0.050NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0390.1150.947_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03435First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009940001
MSDEASIAPSPNKPPEPTSPPAALLADSPPTICRLEVAPHFAALTPKEKL
YAHHISRASFLGTRVTLRQHSPESEAIYDLILALYAACAGDWKKLASEGP
VSEKDVQYWLEYATVFLASLGNYKSFGDLKFVPRIPKAELRKLVEYADEE
ASKLFYGVEEVVYSFLPEERNLIGYIDAGHVSAYYPDSPSISKAEIEEVQ
AVTAANGILVENTRLKKVSDSEFHLLFASAEVTAPEGQKTEFVFGEGRKK
LKLVYGDHAELMKKISAECRAAAERSANELQRKMWDEYARSFDIGSIQAH
KESQKYWVQDKGPRVEANIGFVETYRDPAGVRAEWEGFAAMVNEGRTRTF
GELVKRAEDFIARLPWGKDFEKDHFLKPDFTSLEVLTFAGAGIPAGINIP
NYDDIRQEIGFKNVSLGNILSARSPNEVITFLKPEDVALYSELQGPAFEV
QVGVHELLGHGTGKLLQETSPGEYNFDHANPPINPITNEPVGTWYGPNET
WGSIFGGLAASYEECRAELVAMYLGVEKGLLSIFGHVTDQEAEDLLYIEY
LQMARAGLLSVETWDPKSRKWGQAHSQARYFILQVFISAGDGFVTFSHSL
PDMSDLTISIDRSKILTHGRKAVGEYLTKLHVYKSIADVGAGSELYKRMT
EVTDQFKGYREVVMRLKQPRKVFVQANTVLSGDGGVELREYEDSVEGMVK
SYAERGV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig409 dipeptidyl peptidase III [Aspergillus clavatus NRRL 1]2e-89
Contig1464 hypothetical protein CIMG_04201 [Coccidioides immitis RS]1e-111
SY0AAA43YJ20FM1 hypothetical protein CIMG_04201 [Coccidioides immitis RS]2e-59


Manual Annotation:

Please find below the necessary files for GSTUMT00009940001 annotation :

link to GSTUMT00009940001 Artemis file
link to scaffold_63 sequence file
link to scaffold_63ESTs