Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009856001
Length(AA) : 498
Localization : scaffold_61
Number of EST contigs matching the gene: 3
Number of ESTs : 15
  User annotation : No user annotation

Blast Results:

Nr Definition: COP9 signalosome subunit 1 (CsnA), putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001262038.1| Score: 1004 E_value: 1e-107
KEGG Definition: hypothetical protein
Accession: ang:An16g07940 Score: 994 E_value: 1e-106
KOG Definition: COP9 signalosome
Classification: [
Kog Number: KOG0686 Score: 808 E_value: 9e-87
PFAM Definition: PCI, PCI domain. This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15)..
Pfam Number: pfam01399 Score: 181 E_value: 4e-14
Swissprot: Q5BD89|CSN1_EMENI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.170NO0.271NO0.108NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6120.0180.54M548

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.90033First60=0.03301PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009856001
MRLVQPRYRAIPYKQIGLGTTDRSRSSGKHRFREDSRDRIKSWQETRYEG
TLVVGLPKFDLDTYISGYAGRTRIDRLIHISTHSPPLAIEGLKLAIKLLK
QTQDVPRFKFALDILRKLSPEDADAAQDDAWIEKTSRKVVGDTERIEADL
KSYKHNLIKESIRIGHEDLGNHLYASGDLVGAFKCYSRMRDFCTTPKHIV
DMSIQAIKVCIEQGHYLTVQSHVLKIRNLARAPDEEELLRPKLCVVTGLT
QLANGDFRAAARSFLDCPPTLLNTYNEVITANDVATYGGLCALASMERTQ
LKTEVLDNVEFRNFLELEPRMRKAISFFHTAKYSNCLSILEDSKNDFLLD
IHLHKHTNRLFELIRSKGIVQYFIPFSCVTLGSMAQAFATDERTLEKELV
MMIGKGALDARIDTKNRLLTAKETNLRAAVHRETLAVAQNYERLARMKLM
RMNMIRSGLEVRGSKASTGQVNMGIAHGQNSSWTGNSQKAERNWREFM

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1641 hypothetical protein An16g07940 [Aspergillus niger]5e-83
SY0AAA24YD08RM1 No hit found
SY0AAC48YC09FM1 hypothetical protein ATEG_00107 [Aspergillus terreus NIH2624]2e-19


Manual Annotation:

Please find below the necessary files for GSTUMT00009856001 annotation :

link to GSTUMT00009856001 Artemis file
link to scaffold_61 sequence file
link to scaffold_61ESTs