Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009848001
Length(AA) : 1503
Localization : scaffold_61
Number of EST contigs matching the gene: 4
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An01g04760
Specie: [Aspergillus niger]
Accession: ref|XP_001388903.1| Score: 3056 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An01g04760 Score: 3056 E_value: 0.0
KOG Definition: O-linked N-acetylglucosamine transferase OGT
Classification: [Carbohydrate transport and metabolism
Kog Number: KOG4626 Score: 1122 E_value: 1e-122
PFAM Definition: No Hit Found
Swissprot: Q9M8Y0|SEC_ARATH

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.096NO0.327NO0.110NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6410.0590.358M410

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00545First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009848001
MLPSPAFHRHQSDQTGARAAAAPILMSKLLHPSNPNAPNPHYFQHHQPNL
QHPSISQGLPTRPMYRAQPFSAAVPTPSQHTYQENLLRRKTPSGTLPAAY
DAAPMEWSRPTKHILLPTPQSNSPQVHSDPQLTRHLSWDNNVGQGVRPWD
GGGELRSADMIVGGGNIAPTMWVTQPSGQASLDDNLDPYVRQFLLQQNQM
VPPISDNIYIGGRPCGFQPFYNPITAPTASCEDFNSLMSCGNYNPVPRDS
NWYGHYGAWGNGNTTPTQLPQAPVYYVNSVYTPSPHQTNGALLWTSQQLP
AIDSVSVSTFPPHITSPYPLNSPLVNTPEVQLQHLQLDGPSSNPAHHDTT
NPQFRDKILTWAHGVYVDLLAALQAQQRQPEGNSPEANRSRTQLKVRLFP
RPPLQSQMDNWRSNNARTQQLFSAPSPMPDNPSEHSTHGIWSSGEQAYEK
KQPRDCYSAGSLHPASSGIGNNAAHMLNITPLGGLGSVINQRPSLATASA
MAALDMLNELCAGSNWVWLDGMLLGGCLAYGLGDLNRAIDWYSKILEVDH
GHVEALSNLAATLLSLNRREEAEQYWIRAVKKRPSYFEAVEHLVGLLCGE
HRGKEAVDIINFVESKLRRPNRLNGRNPSLSSSGSGDESASTSLSASPEL
KFDYDAEENHAKFPSAKSAVYHGSSEFLIPSSDNGRMLALIHAKGNMLYT
LGDNAGAAKAFEDAVLLGADMQRGGIKGLINKILAALRPAVDGVCASEKL
STANPGAVLLTPEKAVLTTKFVFPTGELPGLRDIPSAAAKRAAISTASNS
LLSLAKIFQDGMSSGHGAGAGGPRSAADVKDILALYYLSLSLHPSPSTAN
NVGILLASVQQVSALTTSPPSIIPRSPGVGQASGINLALQYYHFGLSLDP
RHAHLYTNLGSLLKDINQLNAAIKMYEQAVACDPTFDIALANLANAVKDQ
GRIGDAIEFYRRAVKASPEFAEAVCGLANALNSVCDWKGRGGIKSLNEYS
RPTVPSSLSTPSAPTVLPFHTFTCPLSAKQVRMISQRNGLRISCSTLRAP
WLPPHVFPPPAPPAPCLKIGYVSSDFNNHPLAHLMQSVFGLHDPARAKAY
CYATTASDNSEHRKQIERESPVFHDAHSWGPDRLVQQIVNDGIHILINLN
GFTRGARNEIFAARPAPIQMSFMGFAGTLGAEWCDYLYADSTAIPKETLR
PWRRNVDLEDEGHEGTTSDNGEWVYSENIIFAKYSFFCCDHRQSAPDSKS
RQLGWEEEQTRRWAKRKELFPQLKPDNVILGNFNQLYKIEPTTFRTWLRI
LSRVPKAVLWLLRFPDLGESNLKALAVAWAGEEIASRIIFTDVAPKLQHI
SRAQVCDIFLDTPECNAHTTAADVLWSGTPLLTFPRHKHKMCSRIAASIL
RAAVPQTPEGKAMANSLIVDSEEEYEDRAAALVSNLVYDNDEGRGVGQLG
TIRQVLFEHRWKSALFDTKRWVRDLEDAYHEAWRRWVSGEGGDIYLEGVQ
KMK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1438 hypothetical protein SNOG_05914 [Phaeosphaeria nodorum SN15]3e-96
Contig1793 hypothetical protein SS1G_12478 [Sclerotinia sclerotiorum 1980]7e-88
SY0AAA53YB04FM1 hypothetical protein SS1G_12478 [Sclerotinia sclerotiorum 1980]2e-66
SY0AAB33YN07FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00009848001 annotation :

link to GSTUMT00009848001 Artemis file
link to scaffold_61 sequence file
link to scaffold_61ESTs