Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009828001
Length(AA) : 794
Localization : scaffold_61
Number of EST contigs matching the gene: 2
Number of ESTs : 5
  User annotation : TmelPDEase_I  [+]

Blast Results:

Nr Definition: hypothetical protein BC1G_08417
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001552552.1| Score: 1137 E_value: 1e-122
KEGG Definition: high affinity cAMP phosphodiesterase, putative
Accession: afm:AFUA_1G05230 Score: 985 E_value: 1e-104
KOG Definition: Cyclic nucleotide phosphodiesterase
Classification: [Signal transduction mechanisms].
Kog Number: KOG3689 Score: 537 E_value: 4e-55
PFAM Definition: PDEase_I, 3'5'-cyclic nucleotide phosphodiesterase..
Pfam Number: pfam00233 Score: 447 E_value: 1e-44
Swissprot: Q07343|PDE4B_HUMAN
Gene Ontology:
GO:0005626 = Cellular component: insoluble fraction
GO:0005625 = Cellular component: soluble fraction
GO:0004115 = Molecular function: 3'
5'-cyclic-AMP phosphodiesterase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.114NO0.131NO0.070NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.30.1010.529_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.13722First60=0.01043PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009828001
MHQVDYNVVYVDRRARRDRVQHRDDLLPSPISSGPESSDGNDEAQNENEE
VIHNLQCLLSAFNSVTICTTGTSCVSVLSDVDRNDPTPTLVLLDIPWQPQ
PEEDIVGHEGRHDSGIAADMLYGLPLLKFICNEVDALRMSSLVVPVTFLT
NREPAAANGTLPNQICWSTTETERCCEERELKCIDNGAVDVLVSPIPRER
AKVMYMHCYRARKNVQKSRRVSWVGIDEQKPVREASDYAYLREKMYAYFY
RCGPHMRISSGNIEKIQLAIGSWNFSAHDFSDEELVHCAKLMLEHALEMP
EVEAYRISSDRIVDFLTACRAAYNPKIPYHNFRHVVDVLQAVFYFLLQLR
ALPPYSPGEPVGLGPPPARSLSHLLTPLDALTLLVVAVGHDVGHPGVNNA
FLITLKAPLAQVYNDRSVLESFHCAAFSQVLRRYWPKTVELRKSIIDMIL
ATDMGLHFDYMGRLDEMKEKVLKDGGMDSLKDQAISDYRTLVCALLIKCA
DISNVARTHECSSQWAKILIEEFARQATMESDLGISSSPVAPPVTGSVLA
LAKSQVGFMTLFALPLFISLSEVLPEMQFSVDVLIANKAMWQTEIETITS
ASDGIVDKMFGNSNGPAPGSLSTSAGSKQGGEDLGDGRLGGSHGTHVLGP
VVMESSTTFQSSGNLGGGGSEARLNVLALEPGVQASAEQPTVTVVVTQPK
TLSPDPHALLDEKRPTHQYSSEHLGTQEPPEQDIPDRPRSSPPDLGDHSS
EHSCSKACCGPTAVVSTSTIQRRPSSFFKRVKLWKSWRKETSEA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig966 hypothetical protein MGG_05664 [Magnaporthe grisea 70-15]2e-54
Contig1160 hypothetical protein SS1G_12594 [Sclerotinia sclerotiorum 1980]8e-29


Manual Annotation:

Please find below the necessary files for GSTUMT00009828001 annotation :

link to GSTUMT00009828001 Artemis file
link to scaffold_61 sequence file
link to scaffold_61ESTs