Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009772001
Length(AA) : 535
Localization : scaffold_60
Number of EST contigs matching the gene: 3
Number of ESTs : 23
  User annotation : TmelsdhA  [+]

Blast Results:

Nr Definition: hypothetical protein MGG_00168
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_369076.2| Score: 2373 E_value: 0.0
KEGG Definition: hypothetical protein [EC:1.3.5.1]; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit precursor
Accession: mgr:MGG_00168 Score: 2373 E_value: 0.0
KOG Definition: Succinate dehydrogenase
Classification: [
Kog Number: KOG2403 Score: 2329 E_value: 0.0
PFAM Definition: FAD_binding_2, FAD binding domain. This family includes members that bind FAD. This family includes the flavoprotein subunits from succinate and fumarate dehydrogenase, aspartate oxidase and the alpha subunit of adenylylsulphate reductase..
Pfam Number: pfam00890 Score: 758 E_value: 6e-81
Swissprot: Q9UTJ7|DHSA_SCHPO
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0006105 = Biological process: succinate metabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.098NO0.404NO0.074NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0650.080.919_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00872First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009772001
MHPDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRT
EDGKIYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNT
KYFIEYFAMDLLMEDGECVGVIAYNQEDGTLHRFRAHKTVLATGGYGRTY
FSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGSRG
EGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIRNGRGVGPDKDH
IYLQLSHLPAEVLHERLPGISETAAIFSGVDVTKSPIPVLPTVHYNMGGI
PTRYTGEALTIDENGNDKVVPGLFAAGEAACVSVHGANRLGANSLLDLVV
FGRAVAHTIRDTLTPGTPLKPVSADIGAASIANLDKIRNSDGSKSTAQIR
LDMQKTMQTDVSVFRTQESLDQGVKKIQKVDASYHNLGIKDRSMIWNSDL
VEALELGNLLTCATQTAHAAAARKESRGAHAREDYPERDDENWMKHTLSW
QKEQHGKVDLKYRAVVGNTLDEKECAAVPPFKRVY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig870 conserved hypothetical protein [Sclerotinia sclerotiorum 1980]0.0
Contig4205 hypothetical protein MGG_00168 [Magnaporthe grisea 70-15]6e-30
SY0AAB41YE06FM1 hypothetical protein MGG_00168 [Magnaporthe grisea 70-15]2e-46


Manual Annotation:

Please find below the necessary files for GSTUMT00009772001 annotation :

link to GSTUMT00009772001 Artemis file
link to scaffold_60 sequence file
link to scaffold_60ESTs