Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009721001
Length(AA) : 451
Localization : scaffold_6
Number of EST contigs matching the gene: 1
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_12153
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001802384.1| Score: 419 E_value: 5e-39
KEGG Definition: predicted protein
Accession: aor:AO090009000307 Score: 360 E_value: 2e-32
KOG Definition: Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin
Classification: [
Kog Number: KOG0996 Score: 145 E_value: 6e-10
PFAM Definition: ERM, Ezrin/radixin/moesin family. This family of proteins contain a band 4.1 domain (pfam00373), at their amino terminus. This family represents the rest of these proteins..
Pfam Number: pfam00769 Score: 130 E_value: 4e-08
Swissprot: P53253|NNF2_YEAST
Gene Ontology:
GO:0005624 = Cellular component: membrane fraction

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.080NO0.208NO0.145NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0880.0370.92_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.12039First60=0.00412PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009721001
MHGAALTNGIDGSGKDGTFPLFVRVNGIVWPQTVISKYIRGGDGDKENGV
ITGDVEEEWIIDITGLTGATEYDFEFVKKGGKIVYQASACTMPARASSAA
PPVTKQPSRPLSPITTLMHSLSQASSCLTEKKNRLKVVKKNQKTALSDIR
KETEKNRSLLGNDRGDERAFRRILALKESIKRADEETEKMTKEIEGLQNL
PDKLKAEWKAKKRGWREERDKLLSAQSQAGEVKEAADRQTSTVESEAASL
VQKKERLTVRLGKLCVDLEKLEKEHQQNIETRRKREAERENVEKHRLSLE
KEFSDAILRMEQKTVDFRMYSADNWATFYAYESSIQSQPPLSTLDTGLQG
TNSNRNSLHISTPPGLMLHQGSYTASSSSLPTGTAGPTRERSSSVFSSES
VVTNMSELERSEVIRSTHFPRGNSHDHITPFFPGAVGAGSALVGSPNRKE
V

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3992 hypothetical protein SNOG_12153 [Phaeosphaeria nodorum SN15]2e-31


Manual Annotation:

Please find below the necessary files for GSTUMT00009721001 annotation :

link to GSTUMT00009721001 Artemis file
link to scaffold_6 sequence file
link to scaffold_6ESTs