Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009704001
Length(AA) : 697
Localization : scaffold_6
Number of EST contigs matching the gene: 4
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_04733
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001557017.1| Score: 1861 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An01g05070 Score: 1836 E_value: 0.0
KOG Definition: No Hit Found
PFAM Definition: SPB_interacting, Spindle pole body interacting protein. Yeast YOR129C has been shown to interact with the outer plaque of the spindle pole body..
Pfam Number: pfam08616 Score: 1794 E_value: 0.0
Swissprot: Q99222|YHS9_YEAST
Gene Ontology:
GO:0005824 = Cellular component: outer plaque of spindle pole body
GO:0005200 = Molecular function: structural constituent of cytoskeleton
GO:0030003 = Biological process: cellular cation homeostasis
GO:0042493 = Biological process: response to drug

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.114NO0.213NO0.085NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6550.0350.414M438

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03638First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009704001
MSVPTPSNAASVRTASGSADTWGTKVSARSSRSSREEHNQLHVEYILVAE
FSIDKGPTMEHQYPNAISGDEHMLAELMLPDQAHVRFQDWTIFFLHKDAE
QSEDQMDPTGHAPLIYVLNLVNTKHDKEAKRGAKVKAMAICTRHSFLHIY
KPILLLALEEYFKSPTLDTLAELFTAVNSMDLSPMPRLSIFERQVLAASD
KKEMFSEKFDEMAMASPNAVVHQMRSPSAAGMITASDQDGDLRPTTYIDL
APGRNKIVNGKITINRDSHEFETKVVYNGIPVPIRVPVAVLPETVGDFSL
IQLITTFSNPHSQNPQPFALHPHLTTNGPYTHPIMVLVNGLLTQKRIVFL
SHGRPSGDVADHVLAACALASGGILRGFTRHAFPYTDLSKVDELLLVTGF
IAGVTNPTFANHPGWWDILCNIDTGRVKISPEIKMSGQSDGAAVFGSMTN
MTGNVDTGDNQFMDDILHCISSRFGEKAVRARWRDWVVRFTRMAAAFEEM
VYGASALWIGHEENHVIRGHGFVWPDEQTKIRDLTANMARIEGWRGSRSY
HAYAQDVQQFYMAKPIKILDLHHHMDRLRALRMSHEDSGKIYTALKDYVI
EYEEINQLLCVIPENQGGLFPIAVGLFHPVQKVRFAVVELLERISTHMAG
RHFFSSLNKFQKLAFIRLQQEKMSTVESPNTGLTMAGLGIGGATTKS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig11 hypothetical protein SS1G_07305 [Sclerotinia sclerotiorum 1980]1e-103
Contig48 conserved hypothetical protein [Ajellomyces capsulatus NAm1]1e-23
SY0AAB30YI11FM1 hypothetical protein BC1G_04733 [Botryotinia fuckeliana B05.10]3e-38
SY0AAB33YA10FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00009704001 annotation :

link to GSTUMT00009704001 Artemis file
link to scaffold_6 sequence file
link to scaffold_6ESTs