Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009630001
Length(AA) : 564
Localization : scaffold_6
Number of EST contigs matching the gene: 2
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: oxidoreductin
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001276620.1| Score: 1361 E_value: 1e-148
KEGG Definition: endoplasmic reticulum membrane-associated oxidoreductin involved in disulfide bond formation
Accession: aor:AO090005000630 Score: 1351 E_value: 1e-147
KOG Definition: Endoplasmic reticulum membrane-associated oxidoreductin involved in disulfide bond formation
Classification: [Posttranslational modification
Kog Number: KOG2608 Score: 989 E_value: 1e-107
PFAM Definition: ERO1, Endoplasmic Reticulum Oxidoreductin 1 (ERO1). Members of this family are required for the formation of disulphide bonds in the ER..
Pfam Number: pfam04137 Score: 933 E_value: 1e-101
Swissprot: Q7SEY9|ERO1_NEUCR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.653YES0.864NO0.685YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0670.7710.102S223

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.39181First60=0.01794PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009630001
MRAQHPQQLFAALIISVSTIVDAKHSICPNKPNELVPDGCASYSTIEELN
KKLYPLVNDITQETDYFGYYRLDLFGRICPFWSDDEGMCGNIACAVTTVD
EKNIPPIWRAEELGKLAGPKASHPATRQPDEPSPLAGALGEETEESCVVE
EDECDERDYCLPEDESAGGKGDYVSLTENPERFTGYAGVGAANVWKAIYR
ENCFSKPRGESSLGSAGGFVGAGKLDLNDLEVDDECLEKRVFHRVISGMH
ASISMHLCWDYLNQSTGEWSPNLSCFVNRFENYPERLQNIYFNYALLARA
IAKLRNYLPTYTFCSGDYYQNRITKSKVVKLANTAASTTPQIFDESLMFR
DEMVGLKEEFRNRFRNVSRLMDCVGCDKCRLWGKVQTQGYGTALKILFEF
DESKNANGNPVLRRTEMVALFNTFGRVSHSLRALEGFNRMLDGKDEADNN
KISAKASEDKETKGKPEKKEKMKVEKSKDTPGAPEEEKQDELPKDQTLGE
EFWQEVGLVWKTFLFVIKSWYNIPRYIFIIAYSEVAQRFDMLMGRPVRDG
LYTWADLNHPRAEL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2708 oxidoreductin [Aspergillus clavatus NRRL 1]4e-51
Contig4260 oxidoreductin [Neosartorya fischeri NRRL 181]7e-78


Manual Annotation:

Please find below the necessary files for GSTUMT00009630001 annotation :

link to GSTUMT00009630001 Artemis file
link to scaffold_6 sequence file
link to scaffold_6ESTs