Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009575001
Length(AA) : 193
Localization : scaffold_59
Number of EST contigs matching the gene: 2
Number of ESTs : 16
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_07768
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001591143.1| Score: 374 E_value: 2e-34
KEGG Definition: predicted protein
Accession: aor:AO090005000618 Score: 342 E_value: 5e-31
KOG Definition: Predicted membrane protein
Classification: [Function unknown].
Kog Number: KOG3292 Score: 361 E_value: 2e-35
PFAM Definition: DUF962, Protein of unknown function (DUF962). This family consists of several eukaryotic and prokaryotic proteins of unknown function. The yeast protein YGL010W has been found to be non-essential for cell growth..
Pfam Number: pfam06127 Score: 356 E_value: 8e-35
Swissprot: P25338|YGB0_YEAST
Gene Ontology:
GO:0005783 = Cellular component: endoplasmic reticulum

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.264NO0.909YES0.221NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0290.5550.825_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=96.0929First60=25.9544PredHel=4
Topology=(21-43,72-94,106-128,138-160)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009575001
MGILDLEQQLIFYGSYHHTKGNILIHLIGVPAIMATTFLFASNTPPLLPL
PFSIPYFPPTLATLSALLYSTLYILMEPFAGLLITPLILLMTAFVTHLTS
ASTTTVTANTVAGYIFVLAWIAQFVGHGVYEKRAPALFDNLVQAVFLAPF
FVWFEVLFWCGYRPELKVRVEEGVVRRLEAFRRKETGNVKGKG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1037 hypothetical protein SS1G_07768 [Sclerotinia sclerotiorum 1980]7e-34
Contig7582 hypothetical protein SS1G_07768 [Sclerotinia sclerotiorum 1980]2e-36


Manual Annotation:

Please find below the necessary files for GSTUMT00009575001 annotation :

link to GSTUMT00009575001 Artemis file
link to scaffold_59 sequence file
link to scaffold_59ESTs