Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009562001
Length(AA) : 828
Localization : scaffold_59
Number of EST contigs matching the gene: 3
Number of ESTs : 12
  User annotation : TmelMSH4  [+]

Blast Results:

Nr Definition: hypothetical protein CIMG_09972
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001238950.1| Score: 1901 E_value: 0.0
KEGG Definition: DNA mismatch repair protein Msh4, putative
Accession: afm:AFUA_1G02000 Score: 1797 E_value: 0.0
KOG Definition: Mismatch repair ATPase MSH4 (MutS family)
Classification: [Replication
Kog Number: KOG0220 Score: 1535 E_value: 1e-171
PFAM Definition: MutS_V, MutS domain V. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS as characterised in, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters..
Pfam Number: pfam00488 Score: 584 E_value: 1e-60
Swissprot: O15457|MSH4_HUMAN
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0003677 = Molecular function: DNA binding
GO:0007131 = Biological process: meiotic recombination

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.100NO0.267NO0.085NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8130.0190.222M357

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.39984First60=0.00593PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009562001
MPRPSTSSSGTSCPPTSTSRPRTSRPRTATSAAGGGAQQVVCAVTESRGV
SATIGLCFVNTATGECVLSEICDTQTYVRTMQKLTVFDPTEILVSPAAVA
PPKSTLLSIIEDYVPGATITEVPRRYFNERSGHDYIQQLAFPDEVTGIKV
AISGKFYAISAAAAALKHIEVSYIRFALHSLRIKYQGSEGSMLIDFSTVH
SLELIQNIQDPKSTECLFGLLDNTLTAMGARLLRASILQPLTDLSTLNAR
LDAVEEFTQHEEMFSQARQALKPFLDMDRLLTALITMPVKPSLKHSEQAI
NNIIILKQSLSSIAPVYDSLGSARSWLLVSIRNLCDSDQIEPVQNLISSI
INEDVVFSKSPLDLRNQRCYAVKSGVNGLLDVARQVYKEVTEDMHQLVED
ISKEYDLPLELKFETGRGYYLRLPASEIEDKPLPPVFVNVVKRKKIVEFS
ALEMLKCNAKISDSLAEVVLMSDNSVQKLVEDIRKEVPALYRVAEGIAVL
DMILSFAQLCTIQDYAGRHPIHEKIHKDQFFPNDVYASQQSRYALVSFAR
QVLAALTAQSTYLRSIALTAVIAQIGSFVPAQYASFPITRRLFARVSMDD
GIEANASTFASEMRETAFILGNVERGSLVIMDELGRGTSTRDGLALAVAV
CEALIESRALVWFATHFKDLARILARRAGVVNLHLRVQMEDENTMTMLYK
VTDGAVEDKNYGLTLARLVGLPQSVLDRAAAVSEVLVGRHEKNMQTLIRA
RDGNMEEDALQPWLNRLQDEFVNRMAAWDAEDMHAPMATAENGEGSEKAD
PGGKQMRDIIEIDSDEGEIDIDQTDDCY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3816 DNA mismatch repair protein Msh4, putative [Neosartorya fischeri NRRL 181]1e-113
Contig5344 DNA mismatch repair protein Msh4, putative [Aspergillus clavatus NRRL 1]2e-10
Contig6946 hypothetical protein SNOG_03709 [Phaeosphaeria nodorum SN15]5e-21


Manual Annotation:

Please find below the necessary files for GSTUMT00009562001 annotation :

link to GSTUMT00009562001 Artemis file
link to scaffold_59 sequence file
link to scaffold_59ESTs