Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009536001
Length(AA) : 716
Localization : scaffold_58
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: cell wall anchored protein
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_752746.1| Score: 311 E_value: 3e-26
KEGG Definition: cell wall anchored protein, putative
Accession: afm:AFUA_1G13760 Score: 311 E_value: 1e-26
KOG Definition: Kelch repeat-containing proteins
Classification: [General function prediction only].
Kog Number: KOG0379 Score: 132 E_value: 3e-08
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.112NO0.198NO0.086NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3210.0420.608_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=57.0396First60=0.62403PredHel=1
Topology=(625-647)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009536001
MNEPFSGKSTLRYGAVIQFSTPPAVGRGRFCLTALPYSTRKPLLHPPVCR
IAPFFRLPLFLLPLSNFKLGLSPPLFFTFTHASRLLSFFPPYCSFPLILL
LKPSLLRVASLRAGVSYSVGRKQAALLHTMRSLVAGLLLWLSTITGLSVS
QSTWTLDPQKHLALMFNHMSVMVNSTIYTIGGTAIYWTPRSTASSIVSNN
NNSVYILRAANSFLRALDLSKPADFEAQFSDTSEVISELPFEIPHVKRGA
AWAYQNTIYYWGGELEWEPVYMNGAFQNRIRELPDPMKYYTYDLGQPRGS
GVWKTVSILEAGGSDTLTGSPSYGEYAYSTEARKGFYLGGVVGRYGLINK
DGSNATTVATNSSRRMNSMVVFDPATNVWKNQTVIAVLNDLREGVLVHVA
GVGEKGILVRMGGIYEGGPSMEFVSFETVYVYDIATSVWYRQPTTSKTNI
FPEGRRGGFCAGAVAAPDNTSFTIYVYGGHDHRSFKTGTWALTMPYFQWI
PVGSTGEPERGRSMTMCHTIGGQLIMVRGGYRDEEGWGDTNGGSYFYDMT
DLTWSFKYQPSEYRVPKTVYDVIGGNGEGGATITGPADDKNFAGGLGKLF
HSTGISPNSPNPSNEGSSSTGSGSSTGGSSRSTGAIAGGVIGGALFAAIG
AGIWALLHFRRRSTDTVGEGGIVDGFQEHSLMGMGENPAAGNHGGNSQWA
HEMYSGPLPELDSTRV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1892 cell wall anchored protein, putative [Aspergillus fumigatus A1163]2e-07


Manual Annotation:

Please find below the necessary files for GSTUMT00009536001 annotation :

link to GSTUMT00009536001 Artemis file
link to scaffold_58 sequence file
link to scaffold_58ESTs