Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009533001
Length(AA) : 683
Localization : scaffold_58
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : TmelHSP78  [+]

Blast Results:

Nr Definition: ATPase with chaperone activity, ATP-binding subunit
Specie: [Thermoanaerobacter tengcongensis MB4]
Accession: ref|NP_623864.1| Score: 1636 E_value: 1e-180
KEGG Definition: clpA; ATPase with chaperone activity, ATP-binding subunit; K03696 ATP-dependent Clp protease ATP-binding subunit ClpC
Accession: tte:TTE2327 Score: 1636 E_value: 1e-180
KOG Definition: Chaperone HSP104 and related ATP-dependent Clp proteases
Classification: [Posttranslational modification
Kog Number: KOG1051 Score: 871 E_value: 7e-94
PFAM Definition: AAA_2, ATPase family associated with various cellular activities (AAA). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model..
Pfam Number: pfam07724 Score: 604 E_value: 6e-63
Swissprot: P35594|CLPE_STRPN
Gene Ontology:
GO:0005886 = Cellular component: plasma membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.346NO0.597NO0.295NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.9270.0140.132M252

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02455First60=0.01926PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009533001
MLSRSIAITRAFRPAANTANLRIRSVNRINLPPLIGLNSFLRGSPVSTIR
GYATARGGGGPQGPFPPGGTHSMDLGGSGEEESALGKFGTDLTARARDGK
LDPVIGRNEEIRRTIQVLSRRTKNNPVLIGSAGTGKTAILEGLAQRIVSG
EVPESMKDKRVVSLDLGQLIAGAKYRGDFEERFKGVLKEVSGAQGKVILF
IDELHTLLGLGKTEGSVDASNLLKPQLSRGELQCCGATTLNEYRQIEKDV
ALARRFQPILVDEPSVQDTISILRGIKDRYEVHHGVRITDNALVSAAILS
NRYITDRFLPDKAIDLVDEAASALRLQQESQKANLQKIKTTKEELEQARV
VSKATGIPTTKLMSGEVEKLVHLEDTLRQSVRGQDDALKSVADAVRLQRA
GLANDHRPTASFMFLGPTGVGKTELCKALATTLFASENAVIRFDMSEFQE
KHTISRLIGSPAGYVGYEDAGQLTEAVRRKPYAVLLFDEFEKAHKDLSSL
LLQVLDEGFLTDAHGRKVDFRSTIIVLTSNIGQDILINDPSSDVAISPAI
KQQVIDIVQHSYPPEFLNRIDEFIIFQRLSKDAIRDIVDIRLRELQEKLD
DRRIKLDVDAKAKDWLSEKGYDTRYGARPLNRLIGKKLLNPLAERLIRGE
IRNSEVARTRVAQEGTELEVLPNHQPSTSSNQR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1139 hypothetical protein MGL_3762 [Malassezia globosa CBS 7966]1e-109
Contig1390 unnamed protein product [Aspergillus oryzae]3e-56


Manual Annotation:

Please find below the necessary files for GSTUMT00009533001 annotation :

link to GSTUMT00009533001 Artemis file
link to scaffold_58 sequence file
link to scaffold_58ESTs