Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009396001
Length(AA) : 698
Localization : scaffold_57
Number of EST contigs matching the gene: 3
Number of ESTs : 48
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001244143.1| Score: 2586 E_value: 0.0
KEGG Definition: acetolactate synthase, large subunit, putative [EC:2.2.1.6]; K01652 acetolactate synthase large subunit
Accession: afm:AFUA_3G10310 Score: 2507 E_value: 0.0
KOG Definition: Thiamine pyrophosphate-requiring enzyme
Classification: [Amino acid transport and metabolism
Kog Number: KOG4166 Score: 2362 E_value: 0.0
PFAM Definition: TPP_enzyme_N, Thiamine pyrophosphate enzyme, N-terminal TPP binding domain..
Pfam Number: pfam02776 Score: 624 E_value: 3e-65
Swissprot: P07342|ILVB_YEAST
Gene Ontology:
GO:0005948 = Cellular component: acetolactate synthase complex
GO:0005739 = Cellular component: mitochondrion
GO:0003984 = Molecular function: acetolactate synthase activity
GO:0050660 = Molecular function: FAD binding
GO:0009082 = Biological process: branched chain family amino acid biosynthetic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.370NO0.788NO0.277NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8790.0470.135M222

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.59697First60=0.00066PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009396001
MLRSASRAPLRILCRWSPGRNFATTPITEVISPHLRKQAVPARKVIPNVP
RNQSTSASARPIPSPAFDQDPPSTAPPAAHAPHPLQPKHGQEMDDSFVGM
SGGQIFHEMMLRHGVKHIFGYPGGAILPVFDAIYRSKHFQFILPRHEQGA
GHMAEGYARASGKPGVVLVTSGPGATNVVTPLQDALSDGTPLVVFCGQVP
TSAIGTDAFQEADVVGISRACTKWNVMIKDVAELPRRINEAFEIATSGRP
GPVLVDLPKDVTAGILRKAIPVASDLPSHPSAASLAAKEARRRYLDASVG
RVAKLVNMAKKPVIYAGQGVIERPEGPKLLKEFADKAKIPVTTTLQGLGG
FDELDEKSLHMLGMHGSPYANLSMQEADLIIALGARFDDRVTGNIAKFAP
QAKLACAEGRGGIVHFEIMPKNINKVVQATEAVEGDVAENLALLIPRVSS
VAERPEWFAQINDWKKRYPFAFERETPGSMIKPQTVIEEINKQTAHMKEE
VVISTGVGQHQMWTAQHFRWRHPRTMITSGGLGTMGYGLPAAIGAKVARP
EATVIDIDGDASFNMTLTELSTAVQFNIGVKVIVLNNEEQGMVTQWQSLF
YEDRFSWTHQQNPDFVKLGEAMGMKSMRCSDPADVPGKIKEMLEYDGPIL
LEVVVDKKVPVLPMVPAGKALHEFLAYDPDREKQRKAALQARFPDGKY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3893 conserved hypothetical protein [Coccidioides immitis RS]5e-10
Contig4341 conserved hypothetical protein [Coccidioides immitis RS]0.0
SY0AAC37YC22FM1 conserved hypothetical protein [Coccidioides immitis RS]3e-58


Manual Annotation:

Please find below the necessary files for GSTUMT00009396001 annotation :

link to GSTUMT00009396001 Artemis file
link to scaffold_57 sequence file
link to scaffold_57ESTs