Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009336001
Length(AA) : 424
Localization : scaffold_55
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_07786
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001591161.1| Score: 519 E_value: 1e-50
KEGG Definition: hypothetical protein
Accession: yli:YALI0B01452g Score: 485 E_value: 5e-47
KOG Definition: Origin recognition complex
Classification: [
Kog Number: KOG2543 Score: 549 E_value: 9e-57
PFAM Definition: No Hit Found
Swissprot: O43114|ORC5_SCHPO
Gene Ontology:
GO:0005664 = Cellular component: nuclear origin of replication recognition complex
GO:0005656 = Cellular component: pre-replicative complex
GO:0005657 = Cellular component: replication fork
GO:0005524 = Molecular function: ATP binding
GO:0003688 = Molecular function: DNA replication origin binding
GO:0006270 = Biological process: DNA replication initiation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.071NO0.223NO0.065NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0870.0380.887_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=5.83572First60=0.00219PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009336001
MTDEMLPTELLTTMNEQFPCRAPQIRRLAALVGTDETPSPPAIVLHGLEA
TGKTTILRTFMDSVNASYTAGVTENVGGGDAGRAGDVCALGVRLSGVLSG
VERKHFLVLDRVDRTREGSSVLFAALGRLGEMIPILTVIFILSVPKPRLL
SSAEPPHIHFAPYTKEESIKILSKYVRRIPFQDIEEYTQKDAKEELYVWQ
KFCGTVWDSLAKGTARGVVQFRAIVDEMWEPFVKPIAEGEYGTRNYSSLY
LLHKDMFRRETNVIDVVVPVGAGEKAVTKIHDLPYYSKFLLCAAYLASYN
PARQDAVFFMKNNDFGRKKRRGGTTGSTKRTAKNRKIHRRLLGPQAFPLE
RLQAIFAAILPHRMSSSADIQTQIATLTSLRLLTKASATDVLEAGAKWRV
NAGWDYIRHVARSVKFDIEDFVAE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB46YM07FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]2e-23
SY0AAD2YM18FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]6e-21


Manual Annotation:

Please find below the necessary files for GSTUMT00009336001 annotation :

link to GSTUMT00009336001 Artemis file
link to scaffold_55 sequence file
link to scaffold_55ESTs