Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009331001
Length(AA) : 929
Localization : scaffold_55
Number of EST contigs matching the gene: 2
Number of ESTs : 78
  User annotation : Tmelpma1-1  [+]

Blast Results:

Nr Definition: hypothetical protein CHGG_10343
Specie: [Chaetomium globosum CBS 148.51]
Accession: ref|XP_001228270.1| Score: 3720 E_value: 0.0
KEGG Definition: PLASMA MEMBRANE ATPASE (PROTON PUMP) [MIPS]
Accession: ncr:NCU01680.1 Score: 3620 E_value: 0.0
KOG Definition: Plasma membrane H+-transporting ATPase
Classification: [Inorganic ion transport and metabolism].
Kog Number: KOG0205 Score: 3047 E_value: 0.0
PFAM Definition: E1-E2_ATPase, E1-E2 ATPase..
Pfam Number: pfam00122 Score: 614 E_value: 6e-64
Swissprot: Q07421|PMA1_AJECA
Gene Ontology:
GO:0005886 = Cellular component: plasma membrane
GO:0008553 = Molecular function: hydrogen-exporting ATPase activity
phosphorylative mechanism

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.023NO0.057NO0.019NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1410.0470.894_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=198.351First60=0PredHel=9
Topology=(121-143,147-165,292-314,329-351,687-709,714-733,750-772,819-841,850-872)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009331001
MSNTVAEHTPSGDHHIRTDFPSAQFDSEKQPIDEKPGIEGIPLDDEDDED
IDGLIQELESLDGHDEEFEESDAAPGSSARPVPEDLLQTDTRTGLTSVEV
DQRRKKYGLNQMKEEKENLILKFLMYFVGPIQFVMEAAAILAAGLQDWVD
FGVICALLLLNACVGFIQEFQAGSIVDELKKTLALKAVVLREGRLFEIEA
PQVVPGDILQIEEGTIIPADGRIVTEDAFLQVDQSAITGESLAVDKHKGD
QCYASSSIKRGEAFMVVTSTGDNTFVGRAAALVNAASAGTGHFTEVLNGI
GTVLLVLVIFTLLIVWVSSFYRSNGIVTILEFTLAITIIGVPVGLPAVVT
TTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLAEP
YTVEGVEADDLMLTACLAASRKKKGLDAIDKAFLKSLRFYPRAKGVLSHY
KVLEFHPFDPVSKKVTAIVQSPQGERIVCVKGAPLFVLRTVEEDHPVPED
IANNYKNKVAEFATRGFRSLGVARKRGEGHWEILGIMPCSDPPRHDTAKT
INEAKTLGLSIKMLTGDAVGIARETSRQLGLGTNVYNAERLGLSGGGDMP
GSEVYDFVEAADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLK
KADTGIAVEGASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYAYVV
YRIALSLHLEIFLGLWIAILNESLNLNLVVFIAIFADIATLAIAYDNAPF
SKSPVKWNLPKLWGMSILLGLVLAIGTWIALTTMFAGGSDDRGIVQNFGN
RDEVLFLEISLTENWLIFITRANGPFWSSIPSWQLSGAILLVDIIATLFT
IFGWFENSEQTSIVAVVRIWIYSFGIFCVLGGVYYLLQDSVAFDNFMHGK
TPKKDSKKRSLEDFVVSLQRVSTQHEKSS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig160 hypothetical protein CHGG_10343 [Chaetomium globosum CBS 148.51]0.0
SY0AAA43YF10FM1 Plasma membrane ATPase (Proton pump) gb|AAB53772.1| ATPase [Ajellomyces capsulatus]3e-50


Manual Annotation:

Please find below the necessary files for GSTUMT00009331001 annotation :

link to GSTUMT00009331001 Artemis file
link to scaffold_55 sequence file
link to scaffold_55ESTs