Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009292001
Length(AA) : 579
Localization : scaffold_55
Number of EST contigs matching the gene: 2
Number of ESTs : 10
  User annotation : TmelAro8b  [+]

Blast Results:

Nr Definition: hypothetical protein SNOG_15475
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001805622.1| Score: 1205 E_value: 1e-130
KEGG Definition: aromatic amino acid aminotransferase and related proteins
Accession: aor:AO090102000498 Score: 1202 E_value: 1e-130
KOG Definition: Aromatic amino acid aminotransferase and related proteins
Classification: [Amino acid transport and metabolism].
Kog Number: KOG0634 Score: 870 E_value: 7e-94
PFAM Definition: Aminotran_1_2, Aminotransferase class I and II..
Pfam Number: pfam00155 Score: 171 E_value: 9e-13
Swissprot: O14192|AATR1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.066NO0.192NO0.060NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5690.0160.644_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.28111First60=0.64081PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009292001
MARHPHPVSGQLEPNREHAKPSDLSHHFNRVTRERTASAIKNLYKYFQAP
GMINLAGALPFPGYFPYDTLESAVSTSGRFPANLIEQLNKPIPVLSTSPP
PPPKRSSPLSSHLIVPKFKPGGPPGGSIDVATTLQYGQASGFGPLAEFIK
DFSINHLHGGRIPYENPEILLTCGNTDGFGKVMQMIAERGDSMLVEEYTY
PNAIQTADPYGVNISPIKVDAEGMLSEGKGGLRDVLENWDHRRFGRRPRL
MYTITIGQNPTGATLSLQRRKEIYRLCERYDVIIIEDDPYWYLQYTESSH
PKDAQTLPANSTGMRYPFLEALTPSYLTIDTSGRVIRLDTFSKTIAPGCR
LGWVTAQPAFIERLTRITESSTQSPSGFAQAMVVQLLRNIWGMDGWVSWL
EGLRAAYEARMRIMCSVLDAYKESAIVCESKDEDSMIVDKVRMYSFDEPM
GGMSVWVHIHITSHPAYAAYLARGHTKREMMNQLWKYGAEEHICLPCPGW
IFGANKNIQEDNSAEFFRLCFAAIEAERILEATERFGRGIREFWGLNADE
IESCCSADGVPEAQGKEAAWGLGCGGFGC

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1437 hypothetical protein SNOG_15475 [Phaeosphaeria nodorum SN15]2e-99
Contig4569 unnamed protein product [Aspergillus oryzae]6e-68


Manual Annotation:

Please find below the necessary files for GSTUMT00009292001 annotation :

link to GSTUMT00009292001 Artemis file
link to scaffold_55 sequence file
link to scaffold_55ESTs