Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009250001
Length(AA) : 361
Localization : scaffold_54
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU07998
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_962668.1| Score: 238 E_value: 3e-18
KEGG Definition: hypothetical protein
Accession: ncr:NCU07998.1 Score: 238 E_value: 2e-18
KOG Definition: No Hit Found
PFAM Definition: CDC27, DNA polymerase subunit Cdc27. This protein forms the C subunit of DNA polymerase delta. It carries the essential residues for binding to the Pol1 subunit of polymerase alpha, from residues 293-332, which are characterised by the motif D--G--VT, referred to as the DPIM motif. The first 160 residues of the protein form the minimal domain for binding to the B subunit, Cdc1, of polymerase delta, the final 10 C-terminal residues, 362-372, being the DNA sliding clamp, PCNA, binding motif..
Pfam Number: pfam09507 Score: 372 E_value: 2e-36
Swissprot: Q9EQ28|DPOD3_MOUSE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.046NO0.195NO0.057NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0890.0620.907_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00302First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009250001
MGNSKKYPESSIIDECEVVTYRMLACRLEVHANVAKQMLYEFHKCHKKKD
ESIHATYIITCERKVIEEAEDGDDDEDEDEDMNLSPFEVTPREKKEGFKY
QKVVKLIGEERLEEVKAEIENIKTVHVHSLRPSRIKDLTVSSACSERIVN
RAAIKAPRPNRPPAIPHAVATAAVSKASEKAETKERVEAKSKRIQRLRRN
VNLRPSCTDETGIFYLFTSWGNAAIKKAESNLSSTAHSPKTEEVPVKMEL
GSEEEEDFEPTLLRDTAEDVKKRRERDDELTKMIEMNIKAKPKRRVREYV
SNEEEEELEKQVPEVQKPPEDEPVELPTGSVVSAVTKGGRRRGRRKVNKK
VQVKDEDGHKA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1278 hypothetical protein SNOG_08975 [Phaeosphaeria nodorum SN15]7e-07


Manual Annotation:

Please find below the necessary files for GSTUMT00009250001 annotation :

link to GSTUMT00009250001 Artemis file
link to scaffold_54 sequence file
link to scaffold_54ESTs