Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009236001
Length(AA) : 564
Localization : scaffold_54
Number of EST contigs matching the gene: 2
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: No Hit Found
KEGG Definition: No significant hit
KOG Definition: Neurexin III-alpha
Classification: [Signal transduction mechanisms].
Kog Number: KOG3514 Score: 119 E_value: 8e-07
PFAM Definition: Syndecan, Syndecan domain. Syndecans are transmembrane heparin sulfate proteoglycans which are implicated in the binding of extracellular matrix components and growth factors..
Pfam Number: pfam01034 Score: 156 E_value: 5e-11
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.885YES0.980YES0.853YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0770.9440.04S118

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=22.9169First60=0.00643PredHel=1
Topology=(424-446)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009236001
MALRYLTMFSALLATVLAKDANDPSPLKNANLLLTPGLLPARPLLGRSHN
PFEPLLSAVTGRLLRHVDPEKRVCGGSALHSACPNDVTKCCPTGGDCCGD
GICCEYGHMCQKNHLGGTVCCPKGRDCSLMLPINPCAIATHTKCAGFDAC
CPPNNTCQLVGDSISCIGLPRGGGRNVLAKRQVSTSGMVSGGPGSGPTSI
PPVTSVPQPPSSSPTRPPSTSIPNEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXTVRPPSSNPPSIITQPPTTTTLPPPITTRSPSTTTRPPAATTRPLS
TTLRPLSSALRPQTVTTTKPVTTTRPGQTSTREASTTTRGGTVITITPTI
GVSGSDVDRSGPTAPTTTVETSTITSAVVSDGITSYVEVPIVTTRVFDPE
LAGGEPTTTPSSGNSGNSGNSGGNSGPKTAVIAGASIGGTILLAVILLGV
FLLAKKKKKAQKEAPDFQGIFTPRPVREPTIPVLPAPPSSGAGGRGSTAS
PVSELSSRGVVTPVPRYGSMYVPPDVPELQEDAVAREGNGAAELSNEYTL
RTAQQRAAADAAGI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1662 No hit found
Contig1847 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00009236001 annotation :

link to GSTUMT00009236001 Artemis file
link to scaffold_54 sequence file
link to scaffold_54ESTs