Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009172001
Length(AA) : 950
Localization : scaffold_53
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_13751
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001547672.1| Score: 1307 E_value: 1e-141
KEGG Definition: hypothetical protein
Accession: ani:AN8120.2 Score: 1120 E_value: 1e-120
KOG Definition: Gamma-tubulin complex
Classification: [
Kog Number: KOG2000 Score: 190 E_value: 9e-15
PFAM Definition: Spc97_Spc98, Spc97 / Spc98 family. The spindle pole body (SPB) functions as the microtubule-organising centre in yeast. Members of this family are spindle pole body (SBP) components such as Spc97 and Spc98 that form a complex with gamma-tubulin..
Pfam Number: pfam04130 Score: 313 E_value: 5e-29
Swissprot: Q96RT8|GCP5_HUMAN
Gene Ontology:
GO:0008274 = Cellular component: gamma-tubulin ring complex
GO:0008017 = Molecular function: microtubule binding
GO:0007020 = Biological process: microtubule nucleation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.095NO0.260NO0.134NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0380.2320.792_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=5.94384First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009172001
MSATPAKVKSLVDELIQSVTGLTAQEDPENFNLCRDFALRNFRGYKFGRT
NQFDVTSKLDGLEEKFRVFNRDDLADAFRSRLEELPSLTSGFTPEILSLF
LSLSDRPLQNSKISDLELLAKSDAPKEPTWEDIIADDPMVGEIWEDVDFG
AESSDEWSDDGYTRPRSRDGFVESLRNQAEDRRRKPQGTGDGEARYKGSG
VEGFIVQADEKGLESLKKAQYWSEGVLPVERELDVSLASGGVNNISLVSE
LQAMREVIFMLLGYPCLLFQRKPNDTTILVNTDSVTKHFALSHASLPAFR
AILSWYAGKGTNINVIRTFARSKTSTTNFPERQTFVASVCDKLAILDQHL
IKLEELLLVGSKGLDQIVSLLALQGELEPFLTPFDLLSDIIAKLPQTGKP
PADLALQHLESLFQLACRLQSTGDQKSFKFIMDIFFSCLQTYLRPIHQWM
ESGELRKDDEVFLISKTRSDEEVELGGLWSDQYSLRKDVSGVLKAPEFVH
AAAARIFITGKSVVFLKRLLEHGIPSSALPLQPQPVNRIDVNLSTACKSG
EYLAPFSDMFAAAFDKWINDRHHSVSSRLRDILYQDCGLWKSLDAIEHIY
LCKNGHLFDTLSQAMFEKVDKGVQTWGDRFLLTELLQGIYGGVGCVEVGR
MRMRAKPESTKSLRERRRTVKMWKSLELSYALPWPIMNVIRKESFDVYNN
IFSFLLQIRRAKYVLERLTLLKEDFRTLGESGEGAMYYSLKHRLLWFANI
IYYYLTNSVLIPQTTHMRQEMARAVHVDGMIQVHNTYIQKTKEQCLLGAK
LAPIHQAITSILDISIFFSDAHLAHSTALKTLDAPNASIHDISVFISSHN
PRRRHRRRQHQTGEPYDYNDISDSNSDSEDYVEDNFEGMNSYISFENEAY
ARQIGHMSERFNTLLEFVRAGLRGVARAGVMPHLEVLAESLEGPGRGGGT

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4299 hypothetical protein BC1G_13751 [Botryotinia fuckeliana B05.10]2e-61
SY0AAB52YP08FM1 No hit found
SY0AAC27YI03FM1 hypothetical protein BC1G_13751 [Botryotinia fuckeliana B05.10]3e-32


Manual Annotation:

Please find below the necessary files for GSTUMT00009172001 annotation :

link to GSTUMT00009172001 Artemis file
link to scaffold_53 sequence file
link to scaffold_53ESTs