Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009163001
Length(AA) : 164
Localization : scaffold_53
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: RNase P and RNase MRP subunit (predicted)
Specie: [Schizosaccharomyces pombe 972h-]
Accession: ref|NP_588479.1| Score: 239 E_value: 5e-19
KEGG Definition: hypothetical protein; K03537 ribonuclease P subunit P14
Accession: spo:SPCC830.09c Score: 239 E_value: 3e-19
KOG Definition: RNase P/RNase MRP subunit POP5
Classification: [Translation
Kog Number: KOG4639 Score: 254 E_value: 4e-23
PFAM Definition: RNase_P_Rpp14, Rpp14/Pop5 family. tRNA processing enzyme ribonuclease P (RNase P) consists of an RNA molecule associated with at least eight protein subunits, hPop1, Rpp14, Rpp20, Rpp25, Rpp29, Rpp30, Rpp38, and Rpp40. This protein is known as Pop5 in eukaryotes..
Pfam Number: pfam01900 Score: 222 E_value: 2e-19
Swissprot: Q9UU90|RNP2_SCHPO
Gene Ontology:
GO:0005783 = Cellular component: endoplasmic reticulum

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.270NO0.762NO0.217NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3180.0240.605_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.16004First60=0.00545PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009163001
MVRYKARYLLITIHYPTEPAPPGSNPTLPFTHPSHPSLTKQSLSNLIRDS
LALQFGDYGAGAAGNMTVKYFSPVTSTGIIKVSRAHYRMLWASLTFMKEV
MGRGAVVSVVRVSGTIKKVQIEATRRAKEGIRRARGVGGEGVGLDVMDIL
DDDGDGDEGSGDEE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4020 RNase P and RNase MRP subunit (predicted) [Schizosaccharomyces pombe 972h-]1e-18


Manual Annotation:

Please find below the necessary files for GSTUMT00009163001 annotation :

link to GSTUMT00009163001 Artemis file
link to scaffold_53 sequence file
link to scaffold_53ESTs