Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009161001
Length(AA) : 340
Localization : scaffold_53
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: Amidohydrolase 2
Specie: [Burkholderia sp. 383]
Accession: ref|YP_373709.1| Score: 381 E_value: 8e-35
KEGG Definition: amidohydrolase 2 [EC:4.1.1.45]; K03392 aminocarboxymuconate-semialdehyde decarboxylase
Accession: bur:Bcep18194_B2954 Score: 381 E_value: 4e-35
KOG Definition: Predicted metal-dependent hydrolase of the TIM-barrel fold
Classification: [General function prediction only].
Kog Number: KOG4245 Score: 180 E_value: 4e-14
PFAM Definition: Amidohydro_2, Amidohydrolase. These proteins are amidohydrolases that are related to pfam01979..
Pfam Number: pfam04909 Score: 185 E_value: 9e-15
Swissprot: Q8R5M5|ACMSD_RAT
Gene Ontology:
GO:0001760 = Molecular function: aminocarboxymuconate-semialdehyde decarboxylase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.092NO0.270NO0.073NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2360.0780.734_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01313First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009161001
MNASTAFIGPGRIDTHHHYFGDSVPELVSEFTNDGAQAFFFPKGVDDHLK
YMDSMGIQTAVLAPSIKMEWHTQWPPARWKNLCERTLKAQLKVQESNPLR
FGTFAMLPFPHVNETLDFVRDIYTREVKPDGFALSTAMGNKYLGDPAFDP
MWDELNMHSAAIFVHPADTAMPPGLEYKPYVFEYAFDTARAMASTIINGV
FTRYPNLKFIFSHNGGAFPFMAKRLDDVGPSAKKMNNGKSVFEVIRTSNI
FVDTAISAPIQWPVTLDIGFPVERIIYASDYPYTAAVGEVAYHGKTAPEE
SGQFTRHELDVKIARENALKGLFPRLAVEYKKAFGHKVDC

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4505 Amidohydrolase 2 [Burkholderia sp. 383]1e-34
SY0AAD59YF23FM1 Amidohydrolase 2 [Burkholderia sp. 383]5e-09


Manual Annotation:

Please find below the necessary files for GSTUMT00009161001 annotation :

link to GSTUMT00009161001 Artemis file
link to scaffold_53 sequence file
link to scaffold_53ESTs