Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009120001
Length(AA) : 842
Localization : scaffold_52
Number of EST contigs matching the gene: 3
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE65325.1| Score: 643 E_value: 1e-64
KEGG Definition: predicted protein
Accession: aor:AO090011000890 Score: 643 E_value: 5e-65
KOG Definition: No Hit Found
PFAM Definition: Fungal_trans, Fungal specific transcription factor domain..
Pfam Number: pfam04082 Score: 182 E_value: 7e-14
Swissprot: Q9UTN0|YII3_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0005819 = Cellular component: spindle

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.034NO0.123NO0.030NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2180.0290.86_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=11.3721First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009120001
MFTQFRLPPAEDHRPEDGANANSRTTHHSTTTITTRTETTSSVNRPRGSR
GVRRPLSCATCIKKKTKCDRKLPCGTCVNRGDALLCSFGPQGTALRQAKE
CAELRQRLRKLESMVQEIRASEKATKAGSPPNGGGGGVGNSDLSSFMPPP
LSPATSASSTLSPPGHHDEDDRDSKNGRPNASLEYDTNGGASYVDQSRWD
CVLLEMGDLKASIRNISEGEVDGEEASAPNDGNKPQQQTQLQQQPQVEKQ
TPASYSLFTAPTNTDAGEFILMLPPKPLIDYLVSRYVEVFASLFHVLHEP
SFMEDYRAFWESPKDVSLSWLALLFVVLGVGVMSLDDNDAVLKEHLHMST
GRGLDLSSYVKRYCDLAMRCLVADRFMESYRLSTIQCLILLIYSKNHSND
GGMSWALLGLTANIAAGLGCHKDGANLGLDPVETEQRRRCWAAILMLDAF
QASAFGRPSMMRATQFETRLPLDVNDVDITRTGVREASSRPTQMTYLNLK
FRLLSITSKIYEKLFGAEKPDYSTIVELDQEIRNEQKTWPGKYSADGPEL
NGLKANDQVHWYILHGHLHQMFLLLHRPYFHKSSAENHPVAPDSRRQCIE
SATSILEIYNILNTKRKYQPYRWYINGLATFHAFHAVIVVSVDLLSMHDP
SQSSTWEAFKQVHDHFSKNAPRSSIATKTLPVVNFLRKKITGRIKAVTPP
PPPVAPLQPPTQAMDTTYTHHPTTAPPPPHRPPQQNQMYKDTSLYPTHSF
AGPHHQNTYHLESITASPTGIIPESMYYQAAAAATIVNPGFVAAAQLGDM
YPQDMELDNWLQGSYMHDLSQWVSPGAFCWDDLNQQCAMPLV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig633 No hit found
Contig1266 No hit found
Contig3489 unnamed protein product [Aspergillus oryzae]9e-51


Manual Annotation:

Please find below the necessary files for GSTUMT00009120001 annotation :

link to GSTUMT00009120001 Artemis file
link to scaffold_52 sequence file
link to scaffold_52ESTs