Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009119001
Length(AA) : 589
Localization : scaffold_52
Number of EST contigs matching the gene: 3
Number of ESTs : 18
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein AN2777.2
Specie: [Aspergillus nidulans FGSC A4]
Accession: ref|XP_660381.1| Score: 1330 E_value: 1e-144
KEGG Definition: hypothetical protein
Accession: ani:AN2777.2 Score: 1330 E_value: 1e-145
KOG Definition: Predicted fumarylacetoacetate hydralase
Classification: [General function prediction only].
Kog Number: KOG1535 Score: 477 E_value: 3e-48
PFAM Definition: FAA_hydrolase, Fumarylacetoacetate (FAA) hydrolase family. This family consists of fumarylacetoacetate (FAA) hydrolase, or fumarylacetoacetate hydrolase (FAH) and it also includes HHDD isomerase/OPET decarboxylase from E. coli strain W. FAA is the last enzyme in the tyrosine catabolic pathway, it hydrolyses fumarylacetoacetate into fumarate and acetoacetate which then join the citric acid cycle. Mutations in FAA cause type I tyrosinemia in humans this is an inherited disorder mainly affecting the liver leading to liver cirrhosis, hetpatocellular carcinoma, renal tubular damages and neurologic crises amongst other symptoms. The enzymatic defect causes the toxic accumulation of phenylalanine/tyrosine catabolites. The E. coli W enzyme HHDD isomerase/OPET decarboxylase contains two copies of this domain and functions in fourth and fifth steps of the homoprotocatechuate pathway; here it decarboxylates OPET to HHDD and isomerises this to OHED. The final products of this pathway are pyruvic acid and succinic semialdehyde..
Pfam Number: pfam01557 Score: 455 E_value: 1e-45
Swissprot: Q8CPT8|Y665_STAES

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.130NO0.379NO0.097NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1080.1820.764_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01802First60=0.00076PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009119001
MTVPASTPLTNFATYIPLNSTQTRVGHLDLESQKITPLSHPSGTPLTNLY
EVISAGKNAQFAPTSRFEPPLKLSSVTLLPPISGRDVLAVGKNYAEHAKE
FNSSGFDSSDKIDQPTHPVIFTKRATSIVACGSEIFPHAGWTETLDYEGE
IGVILGKEGFGIPESEALDYVWGFTIINDVTARERQRDHKQFFLGKSADT
FCPMGPVAVPITSLSDYQSLRITTSVNNELRQDSNLSELIFSIPTLVSTI
SSSQTVQPGDVIATGTPAGVGIGHTPPAYLKPGDVVQVSVSNLGTLTNKI
GTPGKRPPPTPQQSPAPPKNFTQLTTLRNRKQVYIERHGDQTSSNVIIFV
HGLGANTTFYHPLLSPALCKHNLILYDLEGLGQTPTVASSVTSIPTYVDD
LENLMSSLPLPPASKVSLVAHSFGCLIALTYASKHPLQNLILLGPVPIPL
KPAPAEAVLRRADKVRAEGMLPLTETIISAAISQKTRMANPLAVTLSRSI
LRGNDVEGYAKCCTAFAQFTGEGITWDGLRVFGEKVIIAGDEDKSAPLSV
VRKTAGRIQARLVVLEEVGHWLVMEDLEGVGRVVEGVFC

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig70 hypothetical protein AN2777.2 [Aspergillus nidulans FGSC A4]8e-42
Contig1839 hypothetical protein AN2777.2 [Aspergillus nidulans FGSC A4]1e-84
Contig2823 hypothetical protein BC1G_00816 [Botryotinia fuckeliana B05.10]4e-72


Manual Annotation:

Please find below the necessary files for GSTUMT00009119001 annotation :

link to GSTUMT00009119001 Artemis file
link to scaffold_52 sequence file
link to scaffold_52ESTs