Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009095001
Length(AA) : 401
Localization : scaffold_52
Number of EST contigs matching the gene: 2
Number of ESTs : 138
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_12715
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001802935.1| Score: 431 E_value: 2e-40
KEGG Definition: predicted protein
Accession: aor:AO090206000070 Score: 404 E_value: 1e-37
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.079NO0.098NO0.051NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.420.020.725_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.28721First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009095001
MSLSGPSHFQHRASDDSDSSMGTSSDSSASRSTVPSSLPSLEQHESKTAS
PAESEIFDYHPAHDPRESENTYCSTVEDPDDDYPYYDTHPYVHYHKAPPP
QASPSTPSEFAELFPSTRCLSIRHDDSTLDGNMNLRVAHIKRKTIKPAPQ
RPRLQRSVSKALHSFRGRTEAEPVAKLNRQDSGYSSSGFDGEEEEELKSS
SEVTQNNNICTLEFSNYAHVDLTRRGGKGSKKYDFEYWGKSYSWKRVAKQ
VGPHAGAEEISYQLANNSTGNVVAHIVPDPLSPTQAQAEEAKGGIVPPCS
FWLRDSSQDPIILCLADVADVIMATGLTALVDDCIKRRFHKKKTVQLVLP
MPMIKNPMKMNLEYVGPKRLIDEVFNRRPTLSRSQSTQSSRSPLPVRSAT
A

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1429 hypothetical protein SS1G_08270 [Sclerotinia sclerotiorum 1980]6e-51
Contig6790 conserved hypothetical protein [Aspergillus clavatus NRRL 1]7e-36


Manual Annotation:

Please find below the necessary files for GSTUMT00009095001 annotation :

link to GSTUMT00009095001 Artemis file
link to scaffold_52 sequence file
link to scaffold_52ESTs