Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009074001
Length(AA) : 172
Localization : scaffold_52
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_14019
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001585159.1| Score: 355 E_value: 2e-32
KEGG Definition: hypothetical protein
Accession: ang:An16g05450 Score: 344 E_value: 2e-31
KOG Definition: Actin regulatory protein (Wiskott-Aldrich syndrome protein)
Classification: [Signal transduction mechanisms
Kog Number: KOG3671 Score: 135 E_value: 3e-09
PFAM Definition: DUF1421, Protein of unknown function (DUF1421). This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function..
Pfam Number: pfam07223 Score: 126 E_value: 3e-08
Swissprot: P42937|YG4E_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0004725 = Molecular function: protein tyrosine phosphatase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.027NO0.061NO0.034NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.330.0170.77_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009074001
MSGQSATDPAAQRGGGRESGSSRRPGFRRVPPPSLASHPDKQDADHIGGH
IKSSRHVPSESLDYTAAELARQLKDAEKVVFHCALSQQRGPSAALKYLRE
RERLFGQGSTVAAGGTKGEGEGVVGGREDQEGKDRKQEVLVLDGGFVEWQ
AKYGNDERLTENYNKELWEAEH

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB55YL01FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]8e-28


Manual Annotation:

Please find below the necessary files for GSTUMT00009074001 annotation :

link to GSTUMT00009074001 Artemis file
link to scaffold_52 sequence file
link to scaffold_52ESTs