Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009065001
Length(AA) : 972
Localization : scaffold_52
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: GPI-anchor biosynthetic protein (Mcd4), putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001262407.1| Score: 2854 E_value: 0.0
KEGG Definition: GPI-anchor biosynthetic protein (Mcd4), putative [EC:2.7.-.-]; K05285 phosphatidylinositol glycan, class N
Accession: afm:AFUA_4G03970 Score: 2812 E_value: 0.0
KOG Definition: Glycosylphosphatidylinositol anchor synthesis protein
Classification: [Signal transduction mechanisms].
Kog Number: KOG2124 Score: 2207 E_value: 0.0
PFAM Definition: PigN, Phosphatidylinositolglycan class N (PIG-N). Phosphatidylinositolglycan class N (PIG-N) is a mammalian homologue of the yeast protein MCD4P and is expressed in the endoplasmic reticulum. PIG-N is essential for glycosylphosphatidylinositol anchor synthesis. Glycosylphosphatidylinositol (GPI)-anchored proteins are cell surface-localised proteins that serve many important cellular functions..
Pfam Number: pfam04987 Score: 729 E_value: 3e-77
Swissprot: Q4W9R7|MCD4_ASPFU
Gene Ontology:
GO:0005789 = Cellular component: endoplasmic reticulum membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.880YES0.987YES0.609YESN

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0540.9560.013S123

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=305.084First60=22.6458PredHel=14
Topology=(7-29,452-474,481-503,546-568,573-592,597-618,625-644,700-717,724-743,747-764,785-804,824-846,858-877,892-914)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009065001
MARLGRLGFLGLAVLFHLIYIYSIFDIYFVSPIVHGMQQYHVDAPAPAKR
LFLIVGDGLRADKCFQSHDDPDYPSENRYLAPFIRSKVLNDATFGVSHTR
VPTESRPGHVALIAGLYEDVSAVTTGWKLNPVNFDSVFNESRHTWSWGSP
DILPMFKHGASDESRVDAFSYDEEMEDFTADSTNLDIWVFDRVKELFESA
ARNNTINTMLRQDKVVFFLHLLGLDTAGHSYRPYSAEYLRNIKVVDEGVQ
QIHKLVNDFYGNDDKTSWIFTADHGMSDWGSHGDGHPDNTRTPLVAWGAG
IKKPVASKVLEVTGHEDGFSGDWGLGAVQRVDVAQADVAALMAYLIGLNF
PVNSVGELPLEYLDANASMKAEASLANARQILEMYKVKEEQKKSTTLRYT
AFVPLSEGKQSLESRFAEIRGLIDSGSHERAIEKCVELIKVGLEGLRYLQ
TYDWLFLRTLVTAGYLGWIAFSLTTVIDLHVLHGRTEPTRNIGSSIFFIS
SLVAIYSVLMIQKSSWTYYAYAFFPVMFWEEVYARKNSVTEGTRKLVAHL
DSRSAYMGLGAEIIGFLVLLEAIVYGYFHREVFTGCFLLATAWPLLYGSD
FLRKNKLLAAGWIACCCSMSTFTLLPVIKQESESLILLGGFFMFSLGLVY
MTFGETAANGSDGAQVARGQDWVSKSILGSQLGLLGLSMFVTRSSVRSLQ
AKLGLPLGNQAVGWLVLVSSIACPFLHGIRPQSHYLHRLMAIFLTFSPIF
VILSISYEGLFYVIFCLTLVAWVQLEHKIHQHSHRKMQEGLTLADARIAL
FFFFLIQVAFFGTGNVASLSSFSLESVYRLIPVFNPLAMGALLVLKLMVP
FAVISANLGILNRRIGVAPSSLFMVVMAISDVLTLNFFYMVRDEGSWLDI
GTTISHFCISSMLGVFVSALEFMSEVFVGGVSMEGGNAMPSSPSSPASKG
GARVENGESTRGSNGEVANGAS

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB38YG19FM1 hypothetical protein AN7049.2 [Aspergillus nidulans FGSC A4]5e-54
SY0AAC32YC22FM1 hypothetical protein FG01935.1 [Gibberella zeae PH-1]3e-75


Manual Annotation:

Please find below the necessary files for GSTUMT00009065001 annotation :

link to GSTUMT00009065001 Artemis file
link to scaffold_52 sequence file
link to scaffold_52ESTs