Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009052001
Length(AA) : 279
Localization : scaffold_52
Number of EST contigs matching the gene: 2
Number of ESTs : 19
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein AN0668.2
Specie: [Aspergillus nidulans FGSC A4]
Accession: ref|XP_658272.1| Score: 383 E_value: 3e-35
KEGG Definition: hypothetical protein
Accession: ani:AN0668.2 Score: 383 E_value: 2e-35
KOG Definition: Histone acetyltransferase SAGA associated factor SGF29
Classification: [General function prediction only].
Kog Number: KOG3038 Score: 305 E_value: 1e-28
PFAM Definition: DUF1325, Protein of unknown function (DUF1325). This family consists of several hypothetical eukaryotic proteins of around 300 residues in length. The function of this family is unknown..
Pfam Number: pfam07039 Score: 124 E_value: 1e-07
Swissprot: P25554|SGF29_YEAST
Gene Ontology:
GO:0000124 = Cellular component: SAGA complex
GO:0005515 = Molecular function: protein binding
GO:0016573 = Biological process: histone acetylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.047NO0.055NO0.033NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4170.0380.612_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00062First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009052001
MAARNRPRAPLKEEADAHEERDLWTKIVRELQELQRMSERVQVLTTETQR
EEERHAEGDASLEDLKILKKLYTEHQELADKEQLTLQSVLEWNDLLIALR
TATEGGDRGGEKKRKRKIDDAGAADSPSSRNTKVARSMSAAPDPHNGLQK
DSEVAYRLPKQKNAEGMWIQCIIVGIAGDGNKRKYEVQDPEPDEAGGHGT
TYKASANALILIPKDSAGLPPYPPGKQVLARYPETTTFYRAEVMGTKADG
TCRLKFEGEEEVGKETEVERRLVLDVGNK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1040 conserved hypothetical protein [Aspergillus terreus NIH2624]2e-26
Contig6641 hypothetical protein AN0668.2 [Aspergillus nidulans FGSC A4]5e-16


Manual Annotation:

Please find below the necessary files for GSTUMT00009052001 annotation :

link to GSTUMT00009052001 Artemis file
link to scaffold_52 sequence file
link to scaffold_52ESTs