Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009049001
Length(AA) : 2587
Localization : scaffold_52
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: HEAT repeat protein (DRIM), putative
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001267978.1| Score: 4282 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An11g01850 Score: 4212 E_value: 0.0
KOG Definition: DRIM (Down-regulated in metastasis)-like proteins
Classification: [Defense mechanisms].
Kog Number: KOG1823 Score: 1635 E_value: 0.0
PFAM Definition: DRIM, Down-regulated in metastasis. These eukaryotic proteins include DRIM (Down-Regulated In Metastasis), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells. It is believed to be involved in processing of non-coding RNA..
Pfam Number: pfam07539 Score: 388 E_value: 2e-37
Swissprot: O60055|UTP20_SCHPO
Gene Ontology:
GO:0005730 = Cellular component: nucleolus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.054NO0.067NO0.036NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2320.0850.794_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.82278First60=0.00007PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009049001
MTRTSMKPPAGKKGGTKSTKNHTFQSFTQKLQNIKIDPVRKVRRRVLDEG
FERSFFHSALEKWIDLNLSTTFVELFVRPVLPLSESLPHILHHKETIFGL
LVEGIKTRDVNALEPLLDLLTQFAHDLGVEFQGFFKESVGLLAALVAEGF
VEAQVVEWVFGALAYLLKYLSRLLAGDLRPLFGVVRGMLGWGGGRGFVRR
CAGEAIGFLVRRVRAEVVRDLARAVFEDLRECEGAWVPGYMEGLMGLFKE
GCVGVDRGLHSKAPIVLESLIQVAKELGEDIGGRCFKIIEGVLISLIHHT
NDETFYPALRVVYAINNPNDELSTRMSARLLYICLTVRKGNRISDWGTAA
EVAVANTQIIMGLPDDSSGSGERVKETMWESLKAVAMVMQTADMEAVIAR
LGRIMDSVREFQDGRLFLPFCELLADTGVERFRVFMLPYFQRFITAKWAI
AEDNLLYLIPKLGANGSLVPSEDTDRTTMATVLGDKSPVTAGAMNNIREF
LENIGGGGDQDTLRAQAVKIWEYLNAILSLSDSLQGDQLPGGLADALEQL
LNGLFSLPENTKLASLTGKVLTMSSKYPSMRSRNLEEPLAVAFPKLADNA
VFLQGVVGFFSLSTPKKLTDKALISMADKLITNLSSSSHDIRSHSLRCLE
LLHVAKSPRKQVSCVISTAQIIENSPLEVSNARNISLYVRRLAGEYSSAA
KGSWESRVVPYFCFGLLTVHFSPVWDDASATLSKVAERDEEVVAMLAFEW
LERQCETPEASDSGTSDGGKASLNGFECSNLNTIEEVAKKCVMGGFEAVA
DLERKFAKDLKTPTLSTSIARMQALKVLTEVPRIAEKRSRKLVPMFLEWS
TFEDTEDGEDEEETKTQSKWLRKEQSAMLTLFSRFTNPRSLYKSDAVYSA
LLSLLSSGDPKVQTLVLECIFTWRIPAIRTYEDNLKNLLDDARFRDEITH
FVQIGEDESMIQDDHRQKLMPVLLRLLYGRILSRKNATSGKKGMECRRTV
VLASLVNFQQWERELFIEIALGNLAEVSGRFVEKRPERYILHMEALGTAH
VSNRKQMGFVRMAGDMIRQLGSTLLPFMEKIVDAFLYCLVMATKTIDSRE
DIIDGLDDAVAVKAARAIRQGGVKCLGALFSSCPTFPWAHYMPAIFDELV
NPRLDALPIETSQSPSGLLQLFSTWANSKDTVMFLEDYNQTVLSKIAACL
ANKSVKDEVVLFIIKMVKQIVSLAGSEGGVGPRLLEPNVDVLLVNLGDIL
HQSPGKEVLEQAVEAISKIAPFVSGDTETTHLVELSVFLLRQPSRRVSPK
AKGDILKILLHFLPLCVVEKESKLYEDTFRCVSSLFGFFKDRENRETLAG
VFNVFAERDEELVQVAELSRQLNSFSDRRLDEPDFEQRLRAYGKINEDLY
LQFSPKQWIPLIFNMLFFIRDNEELAIRTNSSYALKRFAESCGQKSGTEE
KEAYLNILSETLMPALKNGAREQSEFVRMEYVAIVAHVVKECSFWEEVSD
MKALLVGDDEEANFFNNILHIQQHRRLRALRRLATTSRRENTQSSNITHF
FLPLVEHFVFDQAEDAHNLASETVITIGALAEQLTWTQYRALFRRYTGYL
KSKPELEKIVVRLIGTTVNSLARATAAKGNAAAMVKDGGGDVPMGNAMNR
LAESLPEQRNLAEDISGGFLSPLSEYLHQKEESTVSLRVPIAISIAKLLK
LMPDDMLRLRLPPVLTDVCHILRSRSQESRDMTRKTLTEITTLLGPQYFE
FVLKELRGALLRGYQLHVLSFTMHSILVSVTPTYSPGALDYCVGQMVSVI
MDDIFGVTGMEKDAEGYISKMREVKSSKSYDSMDLIASVTTLPYLGGLIR
PIGALLKENMNLRMSQKIDELLRRITVGLLRNKEVGSEKTLIFCYEVIHE
GYRQDTAEAREKEVDPKTQRYLVNLKVPSKAASGVATSSHMYKLTRFALD
ILRTTLQKHDGLMTSRNLANFIPVIGDALLSKYEEVQISALRVLTTIIRT
PLPSIDEGAEVFMGQALSFIKSCPSMNAELAQASLKLMSSVLRERRSVKI
KERTIGYLLTRVKSDLEEPDRQGATFNFLKAVLARKVVIPEVYDVLDSVA
AIMVTNQTRSVRDLARGVYFQFLMEYPQGRDRLNKQLAFLVKNLDYVHQS
GRQSVLEVVNLLCTKVGDSLIQQVLGTFFVPLVMRLINDDSSECREMAGA
LLRKALERADADNLSTFTMLMKNWLGQDQKPLLVRSALQIYGLYLDAFPT
SAKRDLQFVMGELQSIIRASSTDQDAHWENLYFSLQTWARIVLHFPATTF
SADQAPAWTSIHDCLSFPHAWVRLSAARLTGLLFAEYAAKATLSTTPLDN
GAGLTLSAEAMVHIAHRASSHLNSPELSEELGLQVVKNLLFLTRCFHAAG
VGAISSVPMNDPELDDVEEEQHQQEEGRIRRSALEWLVQRISAILRSERN
IKKGLLGKRFAMQWIAALIQLLPKGDLEPLAKTLVRPLYNVLEVDGMHLM
KDLKPTAQELQSSIAEKLGTTLFAIIYSQVKSEALERRRVRKGKRAILAV
TDPEKAAAKKIKKHERKREVRKEKGRAEREGRWGRGG

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA34YL03FM1 No hit found
SY0AAB44YH09FM1 hypothetical protein DEHA0F19580g [Debaryomyces hansenii CBS767]2e-16


Manual Annotation:

Please find below the necessary files for GSTUMT00009049001 annotation :

link to GSTUMT00009049001 Artemis file
link to scaffold_52 sequence file
link to scaffold_52ESTs