Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00009008001
Length(AA) : 510
Localization : scaffold_51
Number of EST contigs matching the gene: 5
Number of ESTs : 31
  User annotation : No user annotation

Blast Results:

Nr Definition: Ankyrin repeat protein
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP48589.1| Score: 479 E_value: 6e-46
KEGG Definition: hypothetical protein
Accession: ang:An02g10560 Score: 463 E_value: 2e-44
KOG Definition: Ankyrin
Classification: [Cell wall/membrane/envelope biogenesis].
Kog Number: KOG4177 Score: 314 E_value: 2e-29
PFAM Definition: RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain). The RRM motif is probably diagnostic of an RNA binding protein. RRMs are found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. The motif also appears in a few single stranded DNA binding proteins. The RRM structure consists of four strands and two helices arranged in an alpha/beta sandwich, with a third helix present during RNA binding in some cases The C-terminal beta strand (4th strand) and final helix are hard to align and have been omitted in the SEED alignment The LA proteins have a N terminus rrm which is included in the seed. There is a second region towards the C terminus that has some features of a rrm but does not appear to have the important structural core of a rrm. The LA proteins are one of the main autoantigens in Systemic lupus erythematosus (SLE), an autoimmune disease..
Pfam Number: pfam00076 Score: 197 E_value: 7e-16
Swissprot: Q8UVC3|INVS_CHICK

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.217NO0.543NO0.174NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1570.30.613_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.65027First60=0.15777PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00009008001
MMAEVCLTYMDCRSARALPPKLDMALATMPFLEYATCFWGAHAGSGVTET
VKALALRVLDRYENHVSADILWRKKIRNSYWDEEVRGISGLHYIAFWGIV
EITIAMLEAKKWDVNGCDSMGDAPLTWTVKYRKYAIVELLLQEEDIKPNA
VIRDGRVVLSLAVESGDENAVKLLLAHGDIDPNLPDGNGLTPLMYAAMGG
QEDLVRLLLQQRDINPDARESNGRSPLSFAASAGDIGVVKLLLERRDVNP
DPSDNDGRTPLSYAASGEHECVVKSFLECRDINPNSSDGNGRTPLSYAAL
GGYEGVVKLLLGHVDINPNWPDSRGRPPLSYAALWGARGVVKQLLERNDD
TNPDSSDSDGRTPLSFAASRGDEERSVKFSSQSTLPQQTKHKTVLHFYFP
QITVNTMATKLFIRSLSWNTDDVSLRRGFEQFGNVTDAVVVKDRETGRSR
GFGFVTFDDETSANAAIDAMNDNEFEGRRIVVVVAEDRRGGVAVDIATMV
AAEEASDLIS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1249 unnamed protein product [Aspergillus oryzae]4e-20
Contig1385 unnamed protein product [Aspergillus oryzae]4e-20
Contig1852 unnamed protein product [Aspergillus oryzae]1e-30
Contig5861 unnamed protein product [Aspergillus oryzae]3e-11
SY0AAB29YD12FM1 unnamed protein product [Aspergillus oryzae]5e-15


Manual Annotation:

Please find below the necessary files for GSTUMT00009008001 annotation :

link to GSTUMT00009008001 Artemis file
link to scaffold_51 sequence file
link to scaffold_51ESTs