Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008972001
Length(AA) : 593
Localization : scaffold_50
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_00083
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001790779.1| Score: 1294 E_value: 1e-140
KEGG Definition: MFS lactose permease, putative
Accession: afm:AFUA_6G01860 Score: 1240 E_value: 1e-134
KOG Definition: Predicted transporter (major facilitator superfamily)
Classification: [General function prediction only].
Kog Number: KOG0254 Score: 627 E_value: 1e-65
PFAM Definition: Sugar_tr, Sugar (and other) transporter..
Pfam Number: pfam00083 Score: 712 E_value: 2e-75
Swissprot: P07921|LACP_KLULA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.042NO0.152NO0.037NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1320.0560.906_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=260.546First60=0.0002PredHel=12
Topology=(91-113,133-155,162-181,186-208,220-239,254-271,341-363,376-398,405-427,442-464,477-499,503-525)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008972001
MAGERTVGELTTPYGNAVGDGCSESRASGAGGGDITPANTFEMSQYSHTA
SLSSCAPLSKDQKYIRTVAHVDFTKALLAQKPSPWTKSMLKLYCYLFVAF
LNSCINGYDGSIMGGINAMSTYQRYFNMKTTGSSTGVVFAIYSIGHFLGC
FICGPLSDSWGRRWGMFSGALTVIIGTCVQALSTTHASFMGGRFILGLGA
AILTTAGPVYVAEMAHPAWRGTITGLYNTFYCVGGLAATWTMYRTQYWDS
DLSWRLPIWLQSVASGTVLLLCLWCPETPRWLVSNDRNEEAIRVLATYHG
DGNRKSPVVLLSFKEMLEEIVLAGSDKRWWDYSELFNSTNAKWRMVCVAG
MAFFGQWSGNGAVTHFLPVLLDNVGIRSETTQLFHNATLTAVSFGAAIVG
CVLVDRVGRRVVLMTGTGLFVAWWTVITILTSYFGKESNTNTAGSTATIA
FIYLFGITYSVSYTPLQALYPVECLKYETRAKGMGVFAFFTNIATLFNSY
GISVFIGKTSWGFCFLYIAWDILELIVIYLFFVETRARTLEEINEIFKDP
MPRNKSLQKHSIIVTESGILYQGLIGDQQNLESPPLPPSEQKF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4142 hypothetical protein SNOG_00083 [Phaeosphaeria nodorum SN15]7e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00008972001 annotation :

link to GSTUMT00008972001 Artemis file
link to scaffold_50 sequence file
link to scaffold_50ESTs