Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008926001
Length(AA) : 390
Localization : scaffold_50
Number of EST contigs matching the gene: 5
Number of ESTs : 56
  User annotation : Tmelktr2  [+]

Blast Results:

Nr Definition: hypothetical protein
Specie: [Yarrowia lipolytica]
Accession: ref|XP_500395.1| Score: 937 E_value: 3e-99
KEGG Definition: hypothetical protein
Accession: yli:YALI0B01672g Score: 937 E_value: 2e-99
KOG Definition: Glycolipid 2-alpha-mannosyltransferase (alpha-1
Classification: [
Kog Number: KOG4472 Score: 1185 E_value: 1e-130
PFAM Definition: Glyco_transf_15, Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi..
Pfam Number: pfam01793 Score: 1149 E_value: 1e-126
Swissprot: P27810|KTR1_YEAST
Gene Ontology:
GO:0005794 = Cellular component: Golgi apparatus
GO:0000026 = Molecular function: alpha-1
2-mannosyltransferase activity
GO:0000032 = Biological process: cell wall mannoprotein biosynthetic process
GO:0006491 = Biological process: N-glycan processing
GO:0006493 = Biological process: protein amino acid O-linked glycosylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.469NO0.981YES0.432YESN

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8140.1470.116M228

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=20.3181First60=20.3131PredHel=1
Topology=(25-44)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008926001
MDPKLLWQRADTGSRISARFFTRRLSLRVLALLSICVVLYNVVYSTELRR
RLEMNVQAPRHTGQPQHGTDTAELEDGPPSATCFGAELGHNGTEKATLVM
LVRNSELHGALSSIRMVEDRFNRRFHYPWTFLNDKPFTDDFIKYTSGLAS
GPVEYAVIPEDDWSIPDHVNTTIMRAEMLRMAKQEIIYGGSLSYRHMCRF
NSGFFYNQEVMRKYDWYWRVEPGIELYCDINYDPFTFMRENKKIYGFVIS
MYEFRDTITTLWDRTRQFLNHGDYNLCHFWSNFEIASLEFYRSEAYSRYF
EFLDSTGGFFYERWGDAPVHSIGVGLFAPKDSIHHFADFGYSHPPCARCP
QDDESHTSGRCVCSRNKNFDSDSYSCLPRWWKVNRGTGWI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig705 Mannosyltransferase of the KTR1 family, involved in protein N-glycosylation; located in the Golgi apparatus; Yur1p [Saccharomyces cerevisiae]2e-16
Contig1161 conserved hypothetical protein [Botryotinia fuckeliana B05.10]3e-59
Contig2659 No hit found
Contig3297 hypothetical protein [Yarrowia lipolytica]1e-65
SY0AAB28YN24FM1 Mannosyltransferase of the KTR1 family, involved in protein N-glycosylation; located in the Golgi apparatus; Yur1p [Saccharomyces cerevisiae]2e-26


Manual Annotation:

Please find below the necessary files for GSTUMT00008926001 annotation :

link to GSTUMT00008926001 Artemis file
link to scaffold_50 sequence file
link to scaffold_50ESTs