Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008919001
Length(AA) : 60
Localization : scaffold_50
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_03050
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001243609.1| Score: 116 E_value: 2e-11
KEGG Definition: 40S ribosomal protein S25; K02975 small subunit ribosomal protein S25e
Accession: aor:AO090005001059 Score: 112 E_value: 1e-11
KOG Definition: 40S ribosomal protein S25
Classification: [Translation
Kog Number: KOG1767 Score: 102 E_value: 6e-06
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.271NO0.606NO0.309NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6690.1160.109M316

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00097First60=0.00097PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008919001
MPSSPTRPFRTSSIRTFKPTVSSLLLSSKALADLEEKGVIKKVVGHSKLS
IYTRAVAAAE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1556 hypothetical protein CIMG_03050 [Coccidioides immitis RS]3e-25


Manual Annotation:

Please find below the necessary files for GSTUMT00008919001 annotation :

link to GSTUMT00008919001 Artemis file
link to scaffold_50 sequence file
link to scaffold_50ESTs