Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008828001
Length(AA) : 1066
Localization : scaffold_5
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: helicase, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001265345.1| Score: 1737 E_value: 0.0
KEGG Definition: DEAD box helicase Mph1, putative [EC:3.6.1.-]; K01529
Accession: afm:AFUA_1G03050 Score: 1737 E_value: 0.0
KOG Definition: DEAD-box like helicase
Classification: [General function prediction only].
Kog Number: KOG0354 Score: 1106 E_value: 1e-121
PFAM Definition: DEAD, DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression..
Pfam Number: pfam00270 Score: 220 E_value: 3e-18
Swissprot: Q9UT23|MFH1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005730 = Cellular component: nucleolus
GO:0043140 = Molecular function: ATP-dependent 3'-5' DNA helicase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.014NO0.022NO0.014NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0390.0690.96_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=8.75852First60=0.00012PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008828001
MSDDEFGSEDWGDVDEEALIAAANQVEKEQAITSSSSSIPVSRPPPLASL
PVASPQRKQSNPAAGGTSDAPLFLDGDFDNSDDEFRDPPRVIRTAPVART
SLVRSSSGGFRQSTLFGGIVEENGSQPSSTPVLRSWPLVSTQEPPTHHKI
DREAAKTWIYPANIPHRDYQYSIVSRALFSNVLVALPTGLGKTLIAATVI
LNFFRWAPEGQIAFLAPTKPLVAQQIDACFNIVGIPRSATAEMTGNVGVQ
QRRDYWEEKRVFFLTPQTMQNDIARGICDAKRIVCLVIDEAHRATGNYAY
VQVVKLLRRVNNSFRVLALTATPGSTIDKVQAVIDSCGIAGTEIRNLESL
DIRPYVYKRFQHLQVFELTDEMVELRDLYCKCLEPLLKKLNDARAYRVTD
IKAISMFGVQQAGREWMTSNAGRDANPALKGMMLNAFSTLSSLALPLHFL
TEHGVRVFFNKLSEVQAEVFSNPKGGKTKKGIINDENFRKVMGKCQELVS
NKEYSGHPKLDYLASVVLKHFFDAEDAETKRETRIMIFTSYRSSAEEIVR
VLSKHQPIVKPHIFVGQADGKGVEGMKQKDQIEVIKDFQVGIYNVIVATS
IGEEGLDIGEVDMIICYDQQGSSIRLLQRMGRTGRKRDGHVHILLTQGKE
EDNFKRATRDHEFIQGEIESGKRFNYHHDLSPRIVPRDIECVVDRKVIEI
PAENTQPEPPKRKLKGKGKQTKVTKKFLMPDGVKTGFVRASRIGKESDQE
DEEDDTPVEKESPAPDILDPETGLLTRSEEKKLQRTYQTDWSGVDDGVLV
VNPPRADAFPGRQRTLTKTHHVQHGRATISTARALQRMHDMDEEVIQKYK
SNLDMALAAPPPEPARKHLTKAFKPVVPRNKPGLSERPGNAPKPRQTFVP
KRKRGSTSPPDVEMADAPPMIDLVSSREDDDDVRMASDADSISSDTDSDV
GVPKRRRKFATGTSGDEDGEEEGEDFLDVGQMLEKWAPKKTIIPEDDDGE
EEGEGFLDVGRMLGKWAPKKTIMLPPKKTVNRLPKNLRGKPVPTPVPKAT
FNRAKRGKRAVCSDDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA53YF14FM1 predicted protein [Ajellomyces capsulatus NAm1]8e-28


Manual Annotation:

Please find below the necessary files for GSTUMT00008828001 annotation :

link to GSTUMT00008828001 Artemis file
link to scaffold_5 sequence file
link to scaffold_5ESTs