Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008772001
Length(AA) : 737
Localization : scaffold_5
Number of EST contigs matching the gene: 4
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein AN0946.2
Specie: [Aspergillus nidulans FGSC A4]
Accession: ref|XP_658550.1| Score: 1460 E_value: 1e-159
KEGG Definition: hypothetical protein
Accession: ani:AN0946.2 Score: 1460 E_value: 1e-160
KOG Definition: Predicted protein involved in nuclear export of pre-ribosomes
Classification: [Translation
Kog Number: KOG2256 Score: 1363 E_value: 1e-151
PFAM Definition: Noc2, Noc2p family. At least one member, Noc2p from yeast, is required for a late step in 60S subunit export from the nucleus. It has also been shown to co-precipitate with Nug1p, a nuclear GTPase also required for ribosome nucleus export. This family was formerly known as UPF0120..
Pfam Number: pfam03715 Score: 830 E_value: 4e-89
Swissprot: P39744|NOC2_YEAST
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0030690 = Cellular component: Noc1p-Noc2p complex
GO:0030691 = Cellular component: Noc2p-Noc3p complex
GO:0005515 = Molecular function: protein binding
GO:0042255 = Biological process: ribosome assembly
GO:0000054 = Biological process: ribosome export from nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.017NO0.041NO0.015NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2980.0320.813_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.07943First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008772001
MGRIKKSTRKFEAKHLKKTLEDRKAHVKVKQRHQLAEKRKKRVDGNADKD
AEEKEIKKSKRKDDDVELFEDMSVEQFFQGGFEAEEKDNGEVEEKGESND
ELETHRADLSALAEKDPEFFKYLQENDSELLDFTAAEQDGRSGIDIMSEG
ESEDEAPKKKKKKKPKKSEGKELAQNDIAGSSIEVTLRDVETWKRALVEE
KSLRSLKKVVLAFRAAVHVSDVGDNDSGCKYTITDANIYHELLVLALKHV
PDVLNHHLPVKESASGKIRIASDTKKYRSMSPLLKSHSASLLHLLPTLTD
APTQKLLLNSTVPLVPYFLSFRKFLKAYIKAVVDIWAANSSDESTRITAF
LVVRRATVIGDDGLKEMCLKALYAGFVRASRQTSGYTMQGINLMKNSARE
VLGLNSMDKVGYSAGFGYIRQLAIHLRNSITNNSKDSYKTVYNWQYVHSL
DFWSRALSAHCDGFKEAEAGRESPLRPLIYPLIQVTLGAIKLIPTAQYFP
LRFYLLRSLLRLSRATGVYIPLASLLFEVLSSTIFKRKPKPSTLRPLDFS
TTIRAPKSYLPTKTYQDGVGEQVVELLSEFFVLHAKSIAFPELAIPAIVH
AKRWIKKSSVVSLNNALSVLAGKLEANSKWVQERRNKVEFAPNKTDMVDK
FLDDVAWEKTPFGAYVLSQRKVREEKRKIVEESLRQERARRRGGDGDSES
GDEEGHLSVEEEQSEDEDMEDVEDEDEGADDSNDSDA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4474 hypothetical protein An01g10820 [Aspergillus niger]4e-51
Contig5538 hypothetical protein AN0946.2 [Aspergillus nidulans FGSC A4]2e-21
SY0AAA18YK22RM1 No hit found
SY0AAC24YJ20FM1 hypothetical protein BC1G_01369 [Botryotinia fuckeliana B05.10]2e-60


Manual Annotation:

Please find below the necessary files for GSTUMT00008772001 annotation :

link to GSTUMT00008772001 Artemis file
link to scaffold_5 sequence file
link to scaffold_5ESTs