Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008768001
Length(AA) : 715
Localization : scaffold_5
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_04709
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001795121.1| Score: 1103 E_value: 1e-118
KEGG Definition: origin recognition complex subunit 3, putative
Accession: afm:AFUA_8G04240 Score: 1082 E_value: 1e-116
KOG Definition: Origin recognition complex
Classification: [
Kog Number: KOG2538 Score: 296 E_value: 3e-27
PFAM Definition: ORC3_N, Origin recognition complex (ORC) subunit 3 N-terminus. This family represents the N-terminus (approximately 300 residues) of subunit 3 of the eukaryotic origin recognition complex (ORC). Origin recognition complex (ORC) is composed of six subunits that are essential for cell viability. They collectively bind to the autonomously replicating sequence (ARS) in a sequence-specific manner and lead to the chromatin loading of other replication factors that are essential for initiation of DNA replication..
Pfam Number: pfam07034 Score: 380 E_value: 6e-37
Swissprot: Q9JK30|ORC3_MOUSE
Gene Ontology:
GO:0006260 = Biological process: DNA replication

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.013NO0.024NO0.013NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0490.0670.955_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.11189First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008768001
MESTPPEEVYVDEFDPKEHQGCYIFTLDGEEDRPTKHRKTKGKQRATEKA
VVEEEKCPFPVLLDGKETESTIKLRYRTYCKLWEAQEKRTKAILDSFNSK
TLDDVSTFVKDATPEKYEGKIPTALVLAGPNIASHELLFEQLAQRIRSQD
RTGPVVVLTSKDATNLKTILRKLIRDATQQDEGVDDEEEDIVRKSTKLLN
YDLQILQIWCELHKGQKVTVAVQDSEAFDSGILSDLISLFISYLDRIPFV
LLIGIATSVEIFHDKLPKSTIRLMRGNKFDVERAEECLAQIFNDSMTSDE
AVLRLGASVCDFLLERYRDHTQSIQAFVAALKYAYMSHFYANPLSIILGF
IDNTDGLGEVLSTEHVEAIRNVPSFRRYVEGKMAAKEVGEVRKLLTDDNY
VRRAIAERIPESRNYGIELGQALTFLEIGRSCTLIQNNAPRYELYSKALS
GELQTSPSVREFLMSLKRMNSTTLLNLLEKVMQEIQTPAITEPLRPLQEK
IKKLVEEAEASGGKKNLISEFDITNNTLRGTAVSKKVRLGEQKSSLTKQD
TEYSALVQQVYTIAESYLTTNFNSSQHGLQNVLLHEVFFYDLRSPHSAVF
APKPRSTIERGLSQPQDYLACSCCTSADGDEVGIRGTQPPASIIYRLYLE
SGALINIYDLWSAFYSVIAGEEEEFDVPTAQALFYRSLAEMRFLGFVKHT
KKKTDHIAKLAWKGI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig300 hypothetical protein SNOG_04709 [Phaeosphaeria nodorum SN15]4e-60
Contig1230 hypothetical protein SS1G_04444 [Sclerotinia sclerotiorum 1980]1e-26


Manual Annotation:

Please find below the necessary files for GSTUMT00008768001 annotation :

link to GSTUMT00008768001 Artemis file
link to scaffold_5 sequence file
link to scaffold_5ESTs