Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008722001
Length(AA) : 193
Localization : scaffold_5
Number of EST contigs matching the gene: 6
Number of ESTs : 23
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU02737
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_965122.1| Score: 429 E_value: 8e-41
KEGG Definition: hypothetical protein
Accession: ncr:NCU02737.1 Score: 429 E_value: 4e-41
KOG Definition: Predicted cation transporter
Classification: [Inorganic ion transport and metabolism].
Kog Number: KOG3182 Score: 375 E_value: 4e-37
PFAM Definition: ChaC, ChaC-like protein. The ChaC protein is thought to be associated with the putative ChaA Ca2+/H+ cation transport protein in Escherichia coli. Its function is not known. This family also includes homologues regions from several other bacterial and eukaryotic proteins..
Pfam Number: pfam04752 Score: 341 E_value: 3e-33
Swissprot: Q5PPV4|CHAC2_XENLA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.073NO0.283NO0.062NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5520.0410.377M515

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00243First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008722001
MAGFVRRFWQSSEDHRGTPEAPGRVVTLIERSYWKTLNDHDFEDDDQVWG
MAFRIKANRVKDVMRELNIREINGYSIRNDIEVFSFSADVPPIKALVYIG
TPGNPQFVAREGVPGLDELARHIFNSRGPSGENRDYLYNLHKSLTGLCPA
AHDHHVSRLFHRVAEMEAENETKHFGEHGAVGLDTADPRSKDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1454 hypothetical protein SNOG_04760 [Phaeosphaeria nodorum SN15]8e-29
Contig2056 hypothetical protein NCU02737 [Neurospora crassa OR74A]6e-27
Contig2220 hypothetical protein [Yarrowia lipolytica]9e-53
Contig4832 hypothetical protein NCU02737 [Neurospora crassa OR74A]4e-11
SY0AAB55YD09FM1 hypothetical protein [Yarrowia lipolytica]2e-49
SY0AAC28YM15FM1 hypothetical protein [Yarrowia lipolytica]2e-11


Manual Annotation:

Please find below the necessary files for GSTUMT00008722001 annotation :

link to GSTUMT00008722001 Artemis file
link to scaffold_5 sequence file
link to scaffold_5ESTs