Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008634001
Length(AA) : 886
Localization : scaffold_49
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: C6 transcription factor, putative
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001271018.1| Score: 935 E_value: 2e-98
KEGG Definition: hypothetical protein
Accession: ang:An16g04000 Score: 920 E_value: 4e-97
KOG Definition: No Hit Found
PFAM Definition: Fungal_trans, Fungal specific transcription factor domain..
Pfam Number: pfam04082 Score: 188 E_value: 1e-14
Swissprot: P40467|YIN0_YEAST
Gene Ontology:
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.083NO0.380NO0.062NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0830.1640.825_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.76344First60=0.12106PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008634001
MIMLKKRVEIYETLLDQLKGQVDNAGQLAVQRALQEVGACFEEGIYLLFI
TAHHIFLASQSPEVEQYRSTVKNRDGESLVTADICSTGSVDRIRQDPNPA
DNTYPTGYMGKNSEVAWIQRIVQQLSSEANKTHGTKGDEDYKFETPTYHL
DDLSVSIVGGDINPFYLPPKDIADQLLGAFFETVYPTFPIVLKGLFMAQY
DAFFQWFFPPGSSKRWLAMLNLMFAISALYGRLINAEWKGESELEHLRYF
ARARVLSLDEGSMFEVPDLQQVQVVGLAGIYLIASNQTNRAWNVVGLAVR
YAQTLGLNLRNDVPEFDEVEKEMRVRMWYTLYSLDHLLCTMTGRPACIQN
KDCSVPMPRPVEQEQYLSEEAFGSELRRYSPSHDPPDPFVQHIKQGPSMP
LHIPPIIPEYPATYFIEHTKLNQITSDVLSQLYRPATKSRSWSDIQGIIS
ALELKVMKWRADLPLLLDFGKRHREQTYSYLTLRQRMALAFQYQYIRIII
NRPCLCRLDSRIPNESKRSRGFNRSAAAACVEAAREMIALLPDEPNPVGL
ISRSPWWCLLHYLVSAGTVLIVEIAMRAEHNPQQADGLLKDSKKVISWLR
AMGTNNLGAERSCTVLSKLLIVAAPKIGGDTSDVQRDFPPSKRRSKDDDN
YSRAHRKAPENHAGGASREGEGEGDYSHHHHQEQSHNDMRGQMGNNQGQP
LGDFPDIFRGLLTDPFPFAGMPIHTNFDNPIAMQEAPPHFMQQNRDQESL
TPNQDNCPDMMQSIQTPHTSMMFPTPEQLQRLSVSAKEEEEEEEAHQQQE
KRQRRKQSQGVGQISLPPRFPPHWVPSPPIHPLPRSHSQGSGEPFSMAGL
AHSFRDSGHGSQTTRASYEDISSSSGSNNAGQRRVG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1849 predicted protein [Ajellomyces capsulatus NAm1]9e-21


Manual Annotation:

Please find below the necessary files for GSTUMT00008634001 annotation :

link to GSTUMT00008634001 Artemis file
link to scaffold_49 sequence file
link to scaffold_49ESTs