Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008558001
Length(AA) : 691
Localization : scaffold_48
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_00209
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001790902.1| Score: 1089 E_value: 1e-116
KEGG Definition: hypothetical protein
Accession: ang:An07g08830 Score: 1071 E_value: 1e-114
KOG Definition: Clathrin assembly protein AP180 and related proteins
Classification: [
Kog Number: KOG0251 Score: 602 E_value: 9e-63
PFAM Definition: ANTH, ANTH domain. AP180 is an endocytotic accessory proteins that has been implicated in the formation of clathrin-coated pits. The domain is involved in phosphatidylinositol 4,5-bisphosphate binding and is a universal adaptor for nucleation of clathrin coats..
Pfam Number: pfam07651 Score: 542 E_value: 1e-55
Swissprot: O60167|YHC3_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.332NO0.604NO0.300NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2180.210.381_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.30375First60=2.16132PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008558001
MAASFEKSVKACVKLRSIVASGVVWFIVARGERWWNQTGVDSGQNLNNGA
TKVKLAAPKSKYVEHILIATHAGEAGIAEVFRALNNRVKDQTWTIVFKSL
IIVHLMIREGEREVTLRYLRKHPRLITVSHYSDAQEQGRNIRHYSQYLLE
RARTYGDVRTDYVRSGEGRLRKLSIEKGLLREVECVQTQIRALLKCTFLD
DDVDNEISLLAFRLLVMDLLVLFHVVNEGVINVLEHYFEMSRYDAERALE
IYKTFTKQTADVVEYLQQARGVETATRLQIPNLKHAPTSLTSSLEEYLHD
PDFDVNRRQYLAQQEAKKSGKPVPAAKPKSPPPGQQPKTSAAQRFPSPTP
ANPVPEQAQPKPVAPDLIDFFESIESEQTHMFSNQPTNGQQIQMPQPQNQ
FAQQAQVDSAFGAQMQQQSAPQQPFVAPPQQFPTQTGPTFATGYQAQNPY
NQVAQQQPLPPIIQTNNLPAIQQTPQQIQTSFTGAGFGGYTPSDQNSVTA
PLMSTVPQRFNQPIQQPNYQQPQHQPQQQQQSLSPAVSLSTGATDTNPFR
QSMMMTGSVSTAPSLYATSPPVSAQPKSTNPFARQASPTNLSPTSPPSAY
PISTQSTSAYPQAMPISAQPTVRSMPTGTNPFARSVSSAGTGLTVPVNAT
GTSVTNPFRQSIMAQQQQNGAAQGTMGAWEEPRNSASFRQE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1387 hypothetical protein SNOG_00209 [Phaeosphaeria nodorum SN15]2e-08
Contig7625 hypothetical protein An07g08830 [Aspergillus niger]7e-68


Manual Annotation:

Please find below the necessary files for GSTUMT00008558001 annotation :

link to GSTUMT00008558001 Artemis file
link to scaffold_48 sequence file
link to scaffold_48ESTs