Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008539001
Length(AA) : 964
Localization : scaffold_48
Number of EST contigs matching the gene: 5
Number of ESTs : 46
  User annotation : MANTUM00008539001  [+]

Blast Results:

Nr Definition: hypothetical protein SS1G_04725
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001594917.1| Score: 583 E_value: 1e-57
KEGG Definition: hypothetical protein
Accession: mgr:MGG_13726 Score: 575 E_value: 5e-57
KOG Definition: Microtubule-associated protein TAU
Classification: [Cytoskeleton].
Kog Number: KOG2418 Score: 235 E_value: 5e-20
PFAM Definition: Trypan_PARP, Procyclic acidic repetitive protein (PARP). This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of Trypanosoma brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated..
Pfam Number: pfam05887 Score: 259 E_value: 8e-23
Swissprot: Q92396|TYRO_PODAN
Gene Ontology:
GO:0004503 = Molecular function: monophenol monooxygenase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.906YES0.964YES0.890YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.050.8390.065S219

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.1384First60=1.13774PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008539001
MRSHSFGALALAFIGSATAAVEPYGQCGGTGYGGETSCPPKFTCVRVNSY
YSTCVETEYYPSVYNPTASQYTDSNYHPSGYTYNPYKHYTSTPPKYTTNT
YYTPRPTNTYKSSDPKHKTDYKPYPTDYKPYPSDYKPDDCQSYPYHKPDY
KPSDYKPYPDYKPTDYKPDYKPSEYKPYPDYKPSDYKPYPDYKPTDYKPY
PTYRPDYKPSDYKPYPTYRPDYKPSDYKPYPTDYKPDYKSPDPYNPYKPY
TTEPYKPYNSDPPYKHCKNDPYKPCPDDEYKPQPRAVVPRQSGAPGGFTP
VTGAPGLQTRMPIEEMQSNSSDVYNMFILALVAMQAEDENRDVSYYQVSG
IHGRPYLPWQHEFDPASNDPGRGYCTHGNALFATWHRPYLILIEQILCEH
ARTIAARFTGADAQRYRDAADRVRMPYWDWSSQTTRSRLPSAVTATDVTV
VQPDAGGAPQTTVIPNPLFSYRFTSDQNRQRYFDGVFQNIPQTCRQPDGA
FNSRNDLAESEMVNTYEPRRANTYNLFSIPTFGEFAASGGPGGDVSPSNW
VSVESIHNNIHAHIGGLNGHMSYVDYAAFDPIFWLHHCNVDRLIAMYQAV
RPNEYVQPGPAVQTFGRVVQPGDRDDVNTPLRPFRRSDGRDWTSADTPNA
TSIMAYGYTYPEIPAEYRTRPAEDLSTFVTGRVNELYRPALGGGGGNNPG
PGTGTGTGNGTGTGTGSGTGTGTGSGTGSGSGSGSGSGSGSGSGSGSGSG
SGSGSGSGSGSGSGSGSGSGTGSPYRYRREWIAYIKMDTGEVDDRYSVLI
FLGDVPSSVQEWQTAPNHVGDCSTFGDERSRMKHVIRGTVPLTEALVASN
VDLDPAACVPYLRKNLKWVVQKGDGSIPINTLKSLKVGVSSSIVEYPNDY
RELPKWRKEETHYDITYQRDGGVQYNETHLVKSEQAPSVISNNSIHEDPG
RRTPLRKRFAKLRF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1018 No hit found
Contig1482 hypothetical protein MGG_13726 [Magnaporthe grisea 70-15]1e-26
Contig2634 hypothetical protein CIMG_07583 [Coccidioides immitis RS]1e-27
Contig5671 No hit found
SY0AAB23YF11FM1 photo-regulated tyrosinase [Polyporus arcularius]3e-10


Manual Annotation:

Please find below the necessary files for GSTUMT00008539001 annotation :

link to GSTUMT00008539001 Artemis file
link to scaffold_48 sequence file
link to scaffold_48ESTs