Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008508001
Length(AA) : 610
Localization : scaffold_48
Number of EST contigs matching the gene: 1
Number of ESTs : 27
  User annotation : MANTUM00008508001  [+]

Blast Results:

Nr Definition: hypothetical protein MGG_03288
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_360745.1| Score: 395 E_value: 4e-36
KEGG Definition: hypothetical protein
Accession: mgr:MGG_03288 Score: 395 E_value: 2e-36
KOG Definition: CREB/ATF family transcription factor
Classification: [Transcription].
Kog Number: KOG0709 Score: 173 E_value: 6e-13
PFAM Definition: bZIP_1, bZIP transcription factor. The Pfam entry includes the basic region and the leucine zipper region..
Pfam Number: pfam00170 Score: 140 E_value: 3e-09
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.029NO0.112NO0.029NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6420.0460.416M419

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00568First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008508001
MSQQNNNMSRNRSSSSLSFNQENSSFNDIDAFIDYDGPNSFIPSPTLSRS
SFSSSQSSTPSMNQKVTNNNHLSATGFPAPSHQYDLHTQQTGSLPVNSGF
YPDFFPPAASMSVSPHENSFMQLDNDSSASLNGSSGMMPAYFYPESTTTG
DSSANFVNPSLVLGTSPIAMDNLESSVKIEVPTVTVPPVGPTAPPMATAG
RFYAGIHQHQAAYEQQQRAIREQQQRQAQQQAPLSQQQQLKVAPKSNVDE
RVDKILTSMKSNAPHPSANGTPPVLPHIAKLKKEEDEMDEDERLLASEEG
KKLTSKERRQLRNKVSARAFRSRRKEYITHLEQEVATKTNEATDLQHENT
RLKEENNKLSELTRMLLSSPAFSVFLDAMQPAAQNDTLEQVPNATTAPEP
KTAPSNTDASLRPNTRKDVNPNLVPVSEDSEWPLAYNTWGTNSPQVFSVL
ELPQGPPSIQDLSGKVVEDEDWKLSSLPVADGFFPIRNEKAGIMDHFDED
EYEAPEDLFDVYEEEMQYNTREETEVDEKKTLDELFPGTGVEALLERLEM
IAGGQAQPEDLFEEVAVEKSLEIVEEKSEEIEESTLGEANRMLDAAEGIY
RRIGLVVGGQ

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1221 hypothetical protein MGG_03288 [Magnaporthe grisea 70-15]7e-36


Manual Annotation:

Please find below the necessary files for GSTUMT00008508001 annotation :

link to GSTUMT00008508001 Artemis file
link to scaffold_48 sequence file
link to scaffold_48ESTs