Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008497001
Length(AA) : 306
Localization : scaffold_47
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: ankyrin repeat protein, putative
Specie: [Trichomonas vaginalis G3]
Accession: ref|XP_001328474.1| Score: 208 E_value: 8e-15
KEGG Definition: ankyrin repeat protein, putative
Accession: tva:TVAG_423030 Score: 208 E_value: 4e-15
KOG Definition: Ankyrin repeat and DHHC-type Zn-finger domain containing proteins
Classification: [General function prediction only].
Kog Number: KOG0509 Score: 180 E_value: 4e-14
PFAM Definition: No Hit Found
Swissprot: Q96Q27|ASB2_HUMAN
Gene Ontology:
GO:0007165 = Biological process: signal transduction

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.332NO0.560NO0.244NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.050.5960.457S523

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.04804First60=0.02162PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008497001
MSLSEIPTELMLIISGYLCPTDLNSLLRTCSSLHETLTIPLYRLACEPEY
EKAALYSSAAVGNRTLVSLIFRRNPELTIFDEDTECPIPSSTPVEKKIEL
ALYLGVDLILHYPDKHKYLDGDGVFYAVATDRPALLKQLLSYHADPSCVT
PSGQTPLHLAVINRNPRAAKLLLQYSANPDEKEFENPDLLCSTSPRGSTA
LHRAVSNNDVEMVRILLEGGASTEVRNMFGKTPWFLAVQIGVEIVSVLLD
AGADMSAKDDIGYTFWDYPMSNKVMQMLDDLYPSEGGERARKSRTRMEKL
SMHDYI

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB46YB01FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00008497001 annotation :

link to GSTUMT00008497001 Artemis file
link to scaffold_47 sequence file
link to scaffold_47ESTs