Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008492001
Length(AA) : 274
Localization : scaffold_47
Number of EST contigs matching the gene: 2
Number of ESTs : 44
  User annotation : No user annotation

Blast Results:

Nr Definition: cytochrome c heme lyase
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001211930.1| Score: 705 E_value: 2e-72
KEGG Definition: hypothetical protein
Accession: fgr:FG08386.1 Score: 553 E_value: 3e-55
KOG Definition: Holocytochrome c synthase/heme-lyase
Classification: [Energy production and conversion
Kog Number: KOG3996 Score: 559 E_value: 3e-58
PFAM Definition: Cyto_heme_lyase, Cytochrome c/c1 heme lyase..
Pfam Number: pfam01265 Score: 615 E_value: 1e-64
Swissprot: P14187|CCHL_NEUCR
Gene Ontology:
GO:0005743 = Cellular component: mitochondrial inner membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.109NO0.253NO0.113NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1750.1040.747_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00031First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008492001
MGWFWAEQEEKPTPRVRPGPPPNHPTSRSPPPSCPMHKSTPSDFSGGSSS
GSDVTSNNDINHLNLMFSSLPQSRTPGQRTNLPTERETSSIPRGDSGLWE
YPSPQQMYNAMRRKGYDDTPEDAVESMVAVHNFLNEGAWGEIVVWERRFG
GGREGFPRLVRFQGKSREMTPKARMFQVLGRVYPEKFGGPPPFDRHDWYV
LRQGGREVRYVIDYYSAPPEPTGEPVFYLDVRPAIDRPSAILERAMVWGG
DLWERASGADVRRAAAEKAKRDSS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6607 cytochrome c heme lyase [Aspergillus terreus NIH2624]1e-76
SY0AAD57YP11FM1 cytochrome c heme lyase [Aspergillus terreus NIH2624]9e-29


Manual Annotation:

Please find below the necessary files for GSTUMT00008492001 annotation :

link to GSTUMT00008492001 Artemis file
link to scaffold_47 sequence file
link to scaffold_47ESTs