Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008471001
Length(AA) : 627
Localization : scaffold_47
Number of EST contigs matching the gene: 5
Number of ESTs : 33
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_06998
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001554410.1| Score: 767 E_value: 3e-79
KEGG Definition: hypothetical protein
Accession: ang:An12g05680 Score: 739 E_value: 3e-76
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: Q00808|HETE1_PODAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.033NO0.112NO0.027NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2060.030.854_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=6.21327First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008471001
MGNQQSNTGSEHFSPSEGHGSRSVANSNIRGDGSGNVHSNNSINSANTTV
NFNYGNTDPSWEHGEILQCLYTSKYQEHRGRVREPAEKTCTWVTAHPKYK
DWLGKERSGLLWLSADPGCGKSVIASFLVKHLERQADAIVCYFFFKDDSD
EQRRATFALCAILHQLFMRNNALCRYAEGAFKGKGKGFTEEVDTLWDILV
RVVAEGGCGNVICVVDALDECDEGTLTRLIHHATNLPGSETSYIPLKFLV
TSRPYHKIERQLGSPATTIRLKGEEEVTATTADVTRVIEAGIEDLESYWE
QPGGLGYLRNLLESSADRTFLWVSLVLDILRNSEDGSPEAFTEIVSTAPP
DIAELYTRILDKSKSPDKARRILNIVVAAARPLTLQEMNIAFRIRREFKS
TKDIGNLAGFEKMVKNLCGLFVRVIDSKIYLVHQTAREFLLKGSLPGLGN
WQYTLCPEESNFILADICISYISLEDFANDPLVKYHFFDYAARNWADHFR
HSGEQQTRLFEFTRLICEAGSKRFQTWLQVYWFAMDQGDTCPRNFTHLMI
ASWLGLGAVVHGVLRGGGYVNARCERYGTALNIAAFRRDEGITAMLLEGN
VGAYICGREYNILHTVSEFNVIQGSQS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4734 No hit found
Contig5108 hypothetical protein BC1G_06998 [Botryotinia fuckeliana B05.10]7e-36
Contig7175 No hit found
SY0AAA9YP16FM1 No hit found
SY0AAB24YA03FM1 hypothetical protein An12g05680 [Aspergillus niger]3e-26


Manual Annotation:

Please find below the necessary files for GSTUMT00008471001 annotation :

link to GSTUMT00008471001 Artemis file
link to scaffold_47 sequence file
link to scaffold_47ESTs